PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi03g05800.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family HB-other
Protein Properties Length: 943aa    MW: 104328 Da    PI: 9.3859
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi03g05800.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox17.47.5e-0669125157
                      TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
         Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                      +r+R  ++++ ++ +++ F  +  +s++e +e+++  g+t +qV+ +F  +R + ++
  Vradi03g05800.1  69 KRPRDLLNPKAVNYMQSIFSIKDSISKKELREISALFGVTATQVRDFFTGQRSRVRR 125
                      799**************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.4E-565120IPR009057Homeodomain-like
PROSITE profilePS500719.76666126IPR001356Homeobox domain
SMARTSM003893.9E-468130IPR001356Homeobox domain
CDDcd000861.26E-469125No hitNo description
SuperFamilySSF466892.78E-669130IPR009057Homeodomain-like
Gene3DG3DSA:1.20.930.102.8E-5226310IPR017923Transcription factor IIS, N-terminal
SuperFamilySSF476764.45E-5230309IPR017923Transcription factor IIS, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006351Biological Processtranscription, DNA-templated
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 943 aa     Download sequence    Send to blast
MDAWNEDFAE QEIGNSAESF QKFLLSQRDL FHSQIDQFQE IVVTQCKLTG VNPLSQEMAA  60
GALSIKIGKR PRDLLNPKAV NYMQSIFSIK DSISKKELRE ISALFGVTAT QVRDFFTGQR  120
SRVRRLVQLS KERALGSNSC EDPHDDKIIP DPVRLSNPAS VNSTIPSSAE EASCTTQDAT  180
LPDLDDSDKH FVDNIFSLMQ QEETFSGQEK LMEWILTIQN FSVLLWFLSR GGGITLATWL  240
SKATAEEQTS VLLLILKVLC HLPLHKAIPM HISAILQSVN KLRFYRTSDI SNRARILLSK  300
WSKLLARNQV IKKPNGVRPS SDGHKELISQ RQACILFSMN NFIGQFVGSE SWHSNIDVPE  360
DFLSLSTESL DNFRKLGSPQ AAKLLPPSLD DSNKKSTFGV SSSRILVFVT SLLTESRERR  420
KVQLVEQPGQ KSVSRSSQVT RAGSVSQGRP MSADDIQKAK MRALFMQNKY GKSGSKESKE  480
TKIDSLNKQP QTIPASIAAC SSKVPTPKID ENKKPLLLAS KTSNRLEAYS KPKVDVKEPL  540
WEKCMRIQTP WKTPAEVELK DSWSVGGGGN SKEVDVQRNR ERREKETIYK TIQEIPPNPK  600
EPWDIEMDYD DTLTLEIPIE QLPDGDGADI AVSPNQVVAH TVEGVASTSS TSVAPAEPDL  660
ELLAVLLKNP ELVFALTSGQ AGSIPGEDVV KLLDMIKRGG ANLGLSENTN GSYGTSVKAP  720
DKVEVSLPSP TPLSDPRTVL AWHQINSLYE QIANLGKTGF PTSLGVVLLA FRVANCNGWS  780
SEASKNPFSR RSVASDRIIQ NHAAVTTTNL LTQIPMTSTT ALRQQPAVVV SSSRHLSNTT  840
VSPYSLHQAT NVNPEKQQPL GHVQIPSSNV GLTMKKNLIT TNAPSVNYSG THSAVAMRGR  900
NYPDSRVNHG RNHRPEWSRQ RGSSEHWDPD RQGNRKWHDQ RR*
Functional Description ? help Back to Top
Source Description
UniProtSeems to play a role in the regulation of flowering time in the autonomous flowering pathway by repressing FLOWERING LOCUS C expression. {ECO:0000269|PubMed:10363371}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi03g05800.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150370.0AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014495914.10.0homeobox protein LUMINIDEPENDENS
SwissprotQ387961e-156LUMI_ARATH; Homeobox protein LUMINIDEPENDENS
TrEMBLA0A1S3TQ770.0A0A1S3TQ77_VIGRR; homeobox protein LUMINIDEPENDENS
STRINGXP_007163082.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF98092934
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.21e-136HB-other family protein
Publications ? help Back to Top
  1. Chakrabortee S, et al.
    Luminidependens (LD) is an Arabidopsis protein with prion behavior.
    Proc. Natl. Acad. Sci. U.S.A., 2016. 113(21): p. 6065-70
    [PMID:27114519]