PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi03g04780.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family NAC
Protein Properties Length: 298aa    MW: 34507.9 Da    PI: 8.0208
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi03g04780.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM49.81.1e-15462162
              NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFs 62
                     +ppG+rF Pt+eel+++yL++k+eg++ ++++vi+ vdiy+++P++Lp +k+        fFs
  Vradi03g04780.1  4 MPPGYRFYPTEEELISFYLHNKLEGEREDMNRVIPVVDIYDYNPSQLPrNKL----LIFLFFS 62
                     79****************************99***************92221....1222333 PP

2NAM84.71.8e-2610718054127
              NAM  54 eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyr 127
                      ++++w+fF++r++++a+g r++r t++gyWkatg+ ++v+s++++ +g+k+t+vfy+grap+g ktdW m+ey+
  Vradi03g04780.1 107 DTEQWFFFIPRQESEARGGRPKRLTTTGYWKATGSPNHVYSSDNRIIGIKRTMVFYSGRAPNGAKTDWKMNEYT 180
                      4679*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-14354IPR003441NAC domain
PROSITE profilePS5100540.1764228IPR003441NAC domain
PfamPF023652.3E-215180IPR003441NAC domain
SuperFamilySSF1019414.05E-27103228IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MDVMPPGYRF YPTEEELISF YLHNKLEGER EDMNRVIPVV DIYDYNPSQL PRNKLLIFLF  60
FSFFHQDSTI EEGASHVFLG FLYRVKHVYV NIFYGFAEIS GEASLRDTEQ WFFFIPRQES  120
EARGGRPKRL TTTGYWKATG SPNHVYSSDN RIIGIKRTMV FYSGRAPNGA KTDWKMNEYT  180
AIKGEPSQVS HHPLNSPLGF LDQPLQQFGF NCILQLRKEF SLCRVYKKSK CLRAFDRRPP  240
PRRNTMRHSI AENGEEQEKG YDYHQHQMLE RSATCSPESS SSGDLDHDQP TLHGPKA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-24418817147NO APICAL MERISTEM PROTEIN
1ut4_B2e-24418817147NO APICAL MERISTEM PROTEIN
1ut7_A2e-24418817147NO APICAL MERISTEM PROTEIN
1ut7_B2e-24418817147NO APICAL MERISTEM PROTEIN
3ulx_A2e-24417915138Stress-induced transcription factor NAC1
4dul_A2e-24418817147NAC domain-containing protein 19
4dul_B2e-24418817147NAC domain-containing protein 19
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi03g04780.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150370.0AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014495662.11e-153NAC domain-containing protein 90-like isoform X1
TrEMBLA0A1S3TPL11e-151A0A1S3TPL1_VIGRR; NAC domain-containing protein 90-like isoform X1
STRINGXP_007162925.11e-130(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF87134123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22380.11e-61NAC domain containing protein 90