PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi03g00270.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family HD-ZIP
Protein Properties Length: 263aa    MW: 29436.4 Da    PI: 7.1792
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi03g00270.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox52.68e-17114168256
                      T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      rk+ +++k+q   Le+ F+++ +++ +++  LAk+l+L  rqV vWFqNrRa+ k
  Vradi03g00270.1 114 RKKLRLSKTQSAFLEDSFKEHTTLNPKQKLVLAKELNLRPRQVEVWFQNRRARTK 168
                      678899***********************************************98 PP

2HD-ZIP_I/II124.64.6e-40114202189
      HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                      +kk+rlsk q+++LE+sF+e+++L+p++K  la+eL+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr+
  Vradi03g00270.1 114 RKKLRLSKTQSAFLEDSFKEHTTLNPKQKLVLAKELNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCESLSEENKRLQKELQELRA 202
                      69*************************************************************************************94 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.601110170IPR001356Homeobox domain
SuperFamilySSF466891.84E-17111179IPR009057Homeodomain-like
SMARTSM003897.2E-15112174IPR001356Homeobox domain
PfamPF000462.5E-14114168IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.2E-16114168IPR009057Homeodomain-like
CDDcd000867.44E-15114171No hitNo description
PROSITE patternPS000270145168IPR017970Homeobox, conserved site
CDDcd146860.00894163202No hitNo description
PfamPF021837.3E-11170202IPR003106Leucine zipper, homeobox-associated
SMARTSM003402.3E-22170213IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MELALSLGHT NNASMGFSVA LPHHTRASSD PPLQLHHLLP STPVLPSPRL PIPCLSHALG  60
MEDTPVRALD DTEDGAALSS PNSSAVSSFQ MELYRNSRKF FEGDSEEDEN GSTRKKLRLS  120
KTQSAFLEDS FKEHTTLNPK QKLVLAKELN LRPRQVEVWF QNRRARTKLK QTEVDCEYLK  180
RCCESLSEEN KRLQKELQEL RAFKTCEPFF MQLPATTLTM CPSCERVATT TSAAASATNN  240
DSVYLNKPRI LSGPHDPLEC FF*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1112118TRKKLRL
2162170RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi03g00270.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150371e-139AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014495582.10.0homeobox-leucine zipper protein HAT14
RefseqXP_022634669.10.0homeobox-leucine zipper protein HAT14
SwissprotP466656e-75HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLA0A1S3TPD00.0A0A1S3TPD0_VIGRR; homeobox-leucine zipper protein HAT14
STRINGXP_007162339.11e-136(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23353382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.14e-74homeobox from Arabidopsis thaliana