PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi0380s00130.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family NAC
Protein Properties Length: 200aa    MW: 22514.1 Da    PI: 4.6365
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi0380s00130.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM102.75e-3251211128
                NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                        lppGf F+Ptdeel+ ++L +k++   ++   +i+++d+  ++Pw+L+ k+ ++ +e yfFs+++        +nr+t++gyWk+ g ++++
  Vradi0380s00130.1   5 LPPGFCFSPTDEELLLHFLYPKTSLPCHPN--IIPDLDLSLHDPWHLNGKALSSGNEQYFFSRAK--------ENRSTENGYWKEIGLTEAI 86 
                        79********************98776555..8**************977778899*****9974........5899*************** PP

                NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                        +s  +e+vglkk Lvf  g+ap+g++t+W+m+ey++
  Vradi0380s00130.1  87 VS-ASEKVGLKKYLVFNLGEAPQGTETSWFMQEYHI 121
                        **.9999***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.32E-403155IPR003441NAC domain
PROSITE profilePS5100538.2855155IPR003441NAC domain
PfamPF023651.1E-196121IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MSVNLPPGFC FSPTDEELLL HFLYPKTSLP CHPNIIPDLD LSLHDPWHLN GKALSSGNEQ  60
YFFSRAKENR STENGYWKEI GLTEAIVSAS EKVGLKKYLV FNLGEAPQGT ETSWFMQEYH  120
ICSSSFSTAS SGSTRGRRKS DQCRSKWVLC KAYEKKSCEG QQGVNCEKDE NDSGTELSWL  180
DEFYMSLDDD IEEVMSLPN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-31315715167NO APICAL MERISTEM PROTEIN
1ut4_B2e-31315715167NO APICAL MERISTEM PROTEIN
1ut7_A2e-31315715167NO APICAL MERISTEM PROTEIN
1ut7_B2e-31315715167NO APICAL MERISTEM PROTEIN
3swm_A2e-31315718170NAC domain-containing protein 19
3swm_B2e-31315718170NAC domain-containing protein 19
3swm_C2e-31315718170NAC domain-containing protein 19
3swm_D2e-31315718170NAC domain-containing protein 19
3swp_A2e-31315718170NAC domain-containing protein 19
3swp_B2e-31315718170NAC domain-containing protein 19
3swp_C2e-31315718170NAC domain-containing protein 19
3swp_D2e-31315718170NAC domain-containing protein 19
4dul_A2e-31315715167NAC domain-containing protein 19
4dul_B2e-31315715167NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that influences tracheary elements and xylem development by negatively regulating secondary cell wall fiber synthesis and programmed cell death. {ECO:0000269|PubMed:18069942, ECO:0000269|PubMed:20458494}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi0380s00130.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150341e-131AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014523778.21e-148NAC domain-containing protein 104
SwissprotQ8GWK61e-53NC104_ARATH; NAC domain-containing protein 104
TrEMBLA0A1S3VZG81e-147A0A1S3VZG8_VIGRR; NAC domain-containing protein 104
STRINGXP_007159851.11e-129(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17363395
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64530.12e-54xylem NAC domain 1
Publications ? help Back to Top
  1. Zhao C, et al.
    XYLEM NAC DOMAIN1, an angiosperm NAC transcription factor, inhibits xylem differentiation through conserved motifs that interact with RETINOBLASTOMA-RELATED.
    New Phytol., 2017. 216(1): p. 76-89
    [PMID:28742236]
  2. Tang N, et al.
    Natural variation at XND1 impacts root hydraulics and trade-off for stress responses in Arabidopsis.
    Nat Commun, 2018. 9(1): p. 3884
    [PMID:30250259]