PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi0312s00040.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family NAC
Protein Properties Length: 366aa    MW: 42363.5 Da    PI: 9.935
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi0312s00040.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM161.72.8e-50191462128
                NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                         pGfrFhPtdeelv +yL++kve+k+l++ e ik+vdiyk++PwdLpk  + ++kewyfF+ r +ky+++ r+nr+t+sg+Wkatg dk+++
  Vradi0312s00040.1  19 LPGFRFHPTDEELVGFYLQRKVEKKPLKI-ELIKQVDIYKYDPWDLPKVNSFGDKEWYFFCIRGRKYRNSVRPNRVTRSGFWKATGIDKSIY 109
                        69***************************.89***************6666699************************************** PP

                NAM  94 sk..kgelvglkktLvfykgrapkgektdWvmheyrl 128
                        +    +e +glkk+Lv+y+g+a kg+ktdW+mhe+rl
  Vradi0312s00040.1 110 CVkePHECIGLKKSLVYYRGSAGKGTKTDWMMHEFRL 146
                        97445566***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.63E-5515176IPR003441NAC domain
PROSITE profilePS5100553.06718177IPR003441NAC domain
PfamPF023653.2E-2520146IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MNAKVQDSDD TKKGEEVVLP GFRFHPTDEE LVGFYLQRKV EKKPLKIELI KQVDIYKYDP  60
WDLPKVNSFG DKEWYFFCIR GRKYRNSVRP NRVTRSGFWK ATGIDKSIYC VKEPHECIGL  120
KKSLVYYRGS AGKGTKTDWM MHEFRLPPNA KSSTNIANAT NNLHEAEVWT LCRIFKRIPS  180
FKKYSPNLKD TTALTKSNTV NSNTSTLDSE NCKPYLICRD PEMMQQLKPV FGQVDEKKHL  240
FLGQFGQLPH LQPPSTPYPT FWNHNVEDYA FANENWDDLR SVVQFAIDPS SVPPPLDQSL  300
KITELSRVKE RMRSRSKKKL QARLDVQVAQ MEAQAAQMEA QARTIHQQQE LQRKQAKEIA  360
MLRGR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-472018319171NO APICAL MERISTEM PROTEIN
1ut4_B2e-472018319171NO APICAL MERISTEM PROTEIN
1ut7_A2e-472018319171NO APICAL MERISTEM PROTEIN
1ut7_B2e-472018319171NO APICAL MERISTEM PROTEIN
3swm_A2e-472018322174NAC domain-containing protein 19
3swm_B2e-472018322174NAC domain-containing protein 19
3swm_C2e-472018322174NAC domain-containing protein 19
3swm_D2e-472018322174NAC domain-containing protein 19
3swp_A2e-472018322174NAC domain-containing protein 19
3swp_B2e-472018322174NAC domain-containing protein 19
3swp_C2e-472018322174NAC domain-containing protein 19
3swp_D2e-472018322174NAC domain-containing protein 19
4dul_A2e-472018319171NAC domain-containing protein 19
4dul_B2e-472018319171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to the 5'- RRYGCCGT-3' consensus core sequence. Central longevity regulator. Negative regulator of leaf senescence. Modulates cellular H(2)O(2) levels and enhances tolerance to various abiotic stresses through the regulation of DREB2A. {ECO:0000269|PubMed:22345491}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi0312s00040.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by H(2)O(2), paraquat, ozone, 3-aminotriazole and salt stress. {ECO:0000269|PubMed:22345491}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150380.0AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014492831.10.0transcription factor JUNGBRUNNEN 1
SwissprotQ9SK551e-91NAC42_ARATH; Transcription factor JUNGBRUNNEN 1
TrEMBLA0A1S3TGD50.0A0A1S3TGD5_VIGRR; transcription factor JUNGBRUNNEN 1
STRINGXP_007146230.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101334112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43000.14e-91NAC domain containing protein 42
Publications ? help Back to Top
  1. Shahnejat-Bushehri S,Nobmann B,Devi Allu A,Balazadeh S
    JUB1 suppresses Pseudomonas syringae-induced defense responses through accumulation of DELLA proteins.
    Plant Signal Behav, 2016. 11(6): p. e1181245
    [PMID:27159137]
  2. Shahnejat-Bushehri S,Tarkowska D,Sakuraba Y,Balazadeh S
    Arabidopsis NAC transcription factor JUB1 regulates GA/BR metabolism and signalling.
    Nat Plants, 2016. 2: p. 16013
    [PMID:27249348]
  3. Shahnejat-Bushehri S, et al.
    Arabidopsis NAC Transcription Factor JUNGBRUNNEN1 Exerts Conserved Control Over Gibberellin and Brassinosteroid Metabolism and Signaling Genes in Tomato.
    Front Plant Sci, 2017. 8: p. 214
    [PMID:28326087]
  4. Sakuraba Y,Bülbül S,Piao W,Choi G,Paek NC
    Arabidopsis EARLY FLOWERING3 increases salt tolerance by suppressing salt stress response pathways.
    Plant J., 2017. 92(6): p. 1106-1120
    [PMID:29032592]
  5. Ebrahimian-Motlagh S, et al.
    JUNGBRUNNEN1 Confers Drought Tolerance Downstream of the HD-Zip I Transcription Factor AtHB13.
    Front Plant Sci, 2017. 8: p. 2118
    [PMID:29326734]