PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi02g13530.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family NF-YB
Protein Properties Length: 127aa    MW: 14094.8 Da    PI: 4.3924
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi02g13530.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB44.43.9e-1417643986
            NF-YB 39 vsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvy 86
                       efi +v+se+++ c++e+r+ti+++ +l al+ lGf dy+e++ + 
  Vradi02g13530.1 17 PKEFINLVSSESNEVCNKEERRTIAPEHVLKALGVLGFGDYIEEVYAA 64
                     47*****************************************98654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF008083.6E-81849IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.106.2E-2318110IPR009072Histone-fold
SuperFamilySSF471131.75E-2118113IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 127 aa     Download sequence    Send to blast
MEPMDIVGKA KEDASLPKEF INLVSSESNE VCNKEERRTI APEHVLKALG VLGFGDYIEE  60
VYAAYEQHKL ETMQDSLKGA KWSNRAEMTE EEALAEQQRM FAEARARMNG GAITSKQPDA  120
DQSLES*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_B9e-211910548133Transcription Regulator NC2 beta chain
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi02g13530.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX8699481e-157JX869948.1 Phaseolus vulgaris TATA-binding protein-associated phosphoprotein Dr1 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014494002.18e-83protein Dr1 homolog
RefseqXP_017422009.18e-83PREDICTED: protein Dr1 homolog
SwissprotP495925e-60NC2B_ARATH; Protein Dr1 homolog
TrEMBLA0A0L9UB342e-81A0A0L9UB34_PHAAN; Uncharacterized protein
TrEMBLA0A1S3TJR52e-81A0A1S3TJR5_VIGRR; protein Dr1 homolog
STRINGXP_007138352.19e-81(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47663358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23090.32e-64nuclear factor Y, subunit B13
Publications ? help Back to Top
  1. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]