PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi02g13200.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family LBD
Protein Properties Length: 119aa    MW: 13331.1 Da    PI: 4.1055
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi02g13200.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26058.61.8e-1835845100
           DUF260  45 llkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                      ++++lp e+r da+sslvyeA+ar+rdPvyG+vg i+ lq+q+++l+ +la++++e
  Vradi02g13200.1   3 MVQELPIEQRADAVSSLVYEAHARVRDPVYGCVGAISYLQNQVSELQMQLAVAQAE 58 
                      899*************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089111.959159IPR004883Lateral organ boundaries, LOB
PfamPF031957.2E-17356IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 119 aa     Download sequence    Send to blast
MLMVQELPIE QRADAVSSLV YEAHARVRDP VYGCVGAISY LQNQVSELQM QLAVAQAEIL  60
CIQMQQEPVM PNPEMENPDH KSYLLQNELP QFLNYASSSN VIYDAVSRDN IYGHDMVS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150370.0AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014493648.12e-79PREDICTED: LOB domain-containing protein 12-like
SwissprotQ8LBW37e-37LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A0L9U9N13e-78A0A0L9U9N1_PHAAN; Uncharacterized protein
TrEMBLA0A0S3S1093e-78A0A0S3S109_PHAAN; Uncharacterized protein
STRINGGLYMA18G02780.14e-70(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16643497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.12e-33LBD family protein