PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi02g11280.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family NAC
Protein Properties Length: 216aa    MW: 24139.3 Da    PI: 9.8069
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi02g11280.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM103.23.4e-3298452128
              NAM  52 kaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      + +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk+++s ++++vg+kk+Lvfy g+ pkg+ktdW+mheyrl
  Vradi02g11280.1   9 SFGEEEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPICS-GTQKVGVKKSLVFYGGKPPKGVKTDWIMHEYRL 84 
                      44789**************************************.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100540.861118IPR003441NAC domain
SuperFamilySSF1019411.57E-398118IPR003441NAC domain
PfamPF023651.2E-151384IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
MLISTTKASF GEEEWYFFSP RDRKYPNGAR PNRAATSGYW KATGTDKPIC SGTQKVGVKK  60
SLVFYGGKPP KGVKTDWIMH EYRLVETKPN NRPPGCDLGH KKNSLRLDDW VLCRIYKKGN  120
TQRSGMEQER DDSMDEMIGE VPSSMNVGHM NARFHLSKIN GNVSVMRTEE NNASPGSFAT  180
LLNQLPQTPS LPQIGSMGDG LLRTQYQLQG TNWYG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-48712165168NO APICAL MERISTEM PROTEIN
1ut4_B5e-48712165168NO APICAL MERISTEM PROTEIN
1ut7_A5e-48712165168NO APICAL MERISTEM PROTEIN
1ut7_B5e-48712165168NO APICAL MERISTEM PROTEIN
4dul_A5e-48712165168NAC domain-containing protein 19
4dul_B5e-48712165168NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor of the NAC family (Probable). Together with NAC018/NARS2, regulates embryogenesis by regulating the development and degeneration of ovule integuments, a process required for intertissue communication between the embryo and the maternal integument (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000305}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi02g11280.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By Jasmonic acid (JA). {ECO:0000269|PubMed:16805732}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150391e-151AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014518387.11e-111NAC transcription factor 56 isoform X3
RefseqXP_022634499.11e-111NAC transcription factor 56 isoform X1
SwissprotQ9LD441e-75NAC56_ARATH; NAC transcription factor 56
TrEMBLA0A1S3VJJ71e-110A0A1S3VJJ7_VIGRR; NAC transcription factor 56 isoform X3
TrEMBLA0A3Q0EVP91e-110A0A3Q0EVP9_VIGRR; NAC transcription factor 56 isoform X1
STRINGXP_007133059.11e-106(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16233498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15510.15e-78NAC domain containing protein 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]