PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi02g09860.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family NAC
Protein Properties Length: 337aa    MW: 37837.5 Da    PI: 7.0084
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi02g09860.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.49.6e-52141391128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrF Ptdeel+v+yL++kv+g++++l  +i+evd+yk++Pw Lp+k+  +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg+dk + +
  Vradi02g09860.1  14 LPPGFRFYPTDEELLVQYLCRKVAGHHFSL-PIIAEVDLYKFDPWVLPAKAVFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKVIST 106
                      79**************************99.88***************8777899**********************************99999 PP

              NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +g++vg+kk Lvfy g+apkg+kt+W+mheyr+
  Vradi02g09860.1 107 -EGRKVGIKKALVFYVGKAPKGSKTNWIMHEYRV 139
                      .999****************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.23E-649165IPR003441NAC domain
PROSITE profilePS5100559.90914164IPR003441NAC domain
PfamPF023653.6E-2615139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MGVQERDPLA QLSLPPGFRF YPTDEELLVQ YLCRKVAGHH FSLPIIAEVD LYKFDPWVLP  60
AKAVFGEKEW YFFSPRDRKY PNGSRPNRVA GSGYWKATGT DKVISTEGRK VGIKKALVFY  120
VGKAPKGSKT NWIMHEYRVL DSSRKNNLGT TKLDDWVLCR IYKKNSSSQK VETNLWGKEC  180
SNGSSPSSSS HVEDMVESFL EIDDKCFNFP GVNSLKTMQQ QDEKFGFQNM RSGFSSDWVT  240
PPDLDSISEF GSGCGTQGMV NYEFNDLFVP SVPPFGHVEF MSGAPMEEEV QSCVRTQRAD  300
GAGYFQQNPN ARNLSGSNET FGLGLTDQQI RFGLRN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A1e-10711707174NAC domain-containing protein 19
3swm_B1e-10711707174NAC domain-containing protein 19
3swm_C1e-10711707174NAC domain-containing protein 19
3swm_D1e-10711707174NAC domain-containing protein 19
3swp_A1e-10711707174NAC domain-containing protein 19
3swp_B1e-10711707174NAC domain-containing protein 19
3swp_C1e-10711707174NAC domain-containing protein 19
3swp_D1e-10711707174NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that acts downstream of MYC2 in the jasmonate-mediated response to Botrytis cinerea infection (PubMed:28733419). With MYC2 forms a transcription module that regulates wounding-responsive genes (PubMed:28733419). Involved in jasmonate- and coronatine-mediated stomatal reopening in response to Pseudomonas syringae pv tomato DC3000 infection (PubMed:25005917). Regulates the expression of threonine deaminase 2 (TD2) through promoter binding (PubMed:28733419). {ECO:0000269|PubMed:25005917, ECO:0000269|PubMed:28733419}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00360DAPTransfer from AT3G15500Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi02g09860.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by jasmonate (JA) (PubMed:25005917, PubMed:28733419, PubMed:30610166). Induced by wounding (PubMed:28733419, PubMed:25005917). Induced by infection with the fungal pathogen Botrytis cinerea (PubMed:28733419). Induced by coronatine (PubMed:25005917). {ECO:0000269|PubMed:25005917, ECO:0000269|PubMed:28733419, ECO:0000269|PubMed:30610166}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150390.0AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014491333.10.0NAC domain-containing protein 72
SwissprotA0A3Q7HH641e-125JA2L_SOLLC; NAC domain-containing protein JA2L
TrEMBLA0A1S3TC400.0A0A1S3TC40_VIGRR; NAC domain-containing protein 72
STRINGXP_007133057.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44293360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15500.11e-114NAC domain containing protein 3
Publications ? help Back to Top
  1. Tomato Genome Consortium
    The tomato genome sequence provides insights into fleshy fruit evolution.
    Nature, 2012. 485(7400): p. 635-41
    [PMID:22660326]
  2. Du M, et al.
    MYC2 Orchestrates a Hierarchical Transcriptional Cascade That Regulates Jasmonate-Mediated Plant Immunity in Tomato.
    Plant Cell, 2017. 29(8): p. 1883-1906
    [PMID:28733419]
  3. Liu Y, et al.
    MYC2 Regulates the Termination of Jasmonate Signaling via an Autoregulatory Negative Feedback Loop.
    Plant Cell, 2019. 31(1): p. 106-127
    [PMID:30610166]