PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi02g04970.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family WOX
Protein Properties Length: 189aa    MW: 20712.1 Da    PI: 4.3508
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi02g04970.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox32.41.5e-102055337
                     --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC CS
         Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl 37
                     +R+++tkeq++ Le+l+++  ++psaee+++++++l
  Vradi02g04970.1 20 SRWNPTKEQITMLENLYKQgIKTPSAEEIQQITARL 55
                     7*****************99**************99 PP

2Wus_type_Homeobox60.34.2e-201859243
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyG 43
                       a++RW+Pt+eQi++Le+lyk+G++tP++eeiq+ita+L++yG
    Vradi02g04970.1 18 ASSRWNPTKEQITMLENLYKQGIKTPSAEEIQQITARLRAYG 59
                       689**************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF000463.0E-82055IPR001356Homeobox domain
CDDcd000860.004032155No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MESGNEELEI GGSNGVAASS RWNPTKEQIT MLENLYKQGI KTPSAEEIQQ ITARLRAYGL  60
CPPYCIPQVQ SENGFYPPHS KVLVPVGFRR RPSEIFVPTD MSNVISNGPL LYEGMQERIS  120
DCNLSYSNQQ TLDLFPLHPT GILEGKTTYQ VSSLASVSAD SSIDINENDP SPLNQPFFDF  180
FTTSGQGS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi02g04970.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150390.0AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014522125.11e-127WUSCHEL-related homeobox 5
TrEMBLA0A1S3VUY81e-126A0A1S3VUY8_VIGRR; WUSCHEL-related homeobox 5
STRINGXP_007132075.11e-100(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF82563044
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.14e-21WUSCHEL related homeobox 2