PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi02g03910.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family Nin-like
Protein Properties Length: 968aa    MW: 106856 Da    PI: 5.2334
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi02g03910.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.23.9e-29597647252
           RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                      ek++sl++l++yFs+++kdAAk++gvc+T+LKriCRq+GI+RWP+Rki+++
  Vradi02g03910.1 597 EKNVSLSVLQQYFSGSLKDAAKSIGVCPTTLKRICRQHGISRWPSRKINKV 647
                      79***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.927579667IPR003035RWP-RK domain
PfamPF020422.5E-26599647IPR003035RWP-RK domain
SuperFamilySSF542774.91E-22862951No hitNo description
Gene3DG3DSA:3.10.20.2407.8E-23864946No hitNo description
SMARTSM006661.2E-21867949IPR000270PB1 domain
PROSITE profilePS5174521.909867949IPR000270PB1 domain
PfamPF005643.0E-16870948IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 968 aa     Download sequence    Send to blast
MEDHFSPKGK ETGYCTSPCT QLEESTSVDG GMKKSASEDM FSNFSELMNF DTYAGWSNSS  60
SMTYHSLANV FSSFSSASYP PSDGLNLVEH GNGPCFMTEV SEIHNGIESS PSCEERGIFQ  120
QMDIQLGFLD EANDSNSFDS EQNRNGSYQQ FNTSDMCNYM ISRSSGRPLD DRMLRALSFF  180
MESVDEGMLA QVWVPIKHGD EFILCTSEQP YLLDPKLAGY REVSRAFTFS AEGKKGSCPG  240
LPARVFTSHV PEWTSNVGYY NKTEYLRLDH ALNHDIRGSI ALPVSDMHSH EPCAVLELVT  300
TKEKPNFDRE LEIVTHALQL VNLKTTMPPR LLPQCLSSNK RAALTEIVDV LRAVCHAHRL  360
PLALTWIPCC YSEGIGDEAE RIRIKEGHTS SNEKCVLCIE ESACYINDGA IGGFVHACVE  420
HHLEEGQGIA GKALQSNHPF FYTDVKTYDI SEYPLVHHAR KYNLNAAVAI RLRSTYTNDD  480
DYILEFFLPV NMTGSSEQQL LLDNLSGTMR RICRSLRTVS DAEITGIEGS VAGLPKEKLT  540
YFFPMSRRNS QIAFINDDND SNQKMSLKAS NNGIEAAHGQ VMNGPRKQIE KKRSTVEKNV  600
SLSVLQQYFS GSLKDAAKSI GVCPTTLKRI CRQHGISRWP SRKINKVNRS LKKIQTVLDS  660
VQGVEGGLKF DPYTGGFIAG GSLMQEIDTH KYILFPERSA VKDPKHATQK PVSVVSAPGS  720
TSENSTIKLD DDDGVCLVEN KIVDSRSALL SNTSVGGFKK DNASSDDCCE DSKSVAMNDG  780
SSQKAKNQDC PEQTCSISLV TDEAEVGVDG GEGIEEHNNL VNSSSTTNSS NGSGSGSMMH  840
GSSSCSQSFE NQKHSKVKPT SVDSESKMIV KASYRGDTIR FKFDPSAGCF QLYEEVATRF  900
KLQNGLFKLK YLDDEEEWVM LENDSDLQEC VEILHDIGTR CVKFLVRDVP CVLSSCDSNN  960
CFLSDSS*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi02g03910.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150390.0AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014494469.10.0protein NLP9
RefseqXP_014494470.10.0protein NLP9
SwissprotO228640.0NLP8_ARATH; Protein NLP8
TrEMBLA0A1S3TL180.0A0A1S3TL18_VIGRR; protein NLP9
STRINGXP_007131923.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF34643465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43500.20.0Nin-like family protein
Publications ? help Back to Top
  1. Yan D, et al.
    NIN-like protein 8 is a master regulator of nitrate-promoted seed germination in Arabidopsis.
    Nat Commun, 2016. 7: p. 13179
    [PMID:27731416]