PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi02g00510.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family NAC
Protein Properties Length: 266aa    MW: 30435.1 Da    PI: 8.9799
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi02g00510.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM81.71.5e-2597353118
              NAM  53 aeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgek 118
                      +e++ewyfFs++dkky+tg+r+nrat++g+Wkatg+dk+++s k+el+g++ktLvfykgrap+g+k
  Vradi02g00510.1   9 EEQNEWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKAIYS-KHELIGMRKTLVFYKGRAPNGQK 73 
                      4567**************************************.999******************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100523.9541101IPR003441NAC domain
SuperFamilySSF1019415.49E-241073IPR003441NAC domain
PfamPF023651.5E-81371IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MGSSRIGTEE QNEWYFFSHK DKKYPTGTRT NRATAAGFWK ATGRDKAIYS KHELIGMRKT  60
LVFYKGRAPN GQKVFKKRVT TMRKVNEHES PSWYDEQVSF IQDMDSPKQT SQSNLVYQLP  120
YHCKKELDVP YQMPRDHFLP LLESPNPMAP YLLDHVNHST TLLPSLLIQE EHVIGQQINL  180
QTTYGKSNRN DQVTDWRVLD KFVASQLSQD GSKDNAYSNT TASIFHGNDS GNCNVQFRHF  240
DKHEMVVPPE NASTSNSSCP IALWK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A1e-18117373135NAC domain-containing protein 19
3swm_B1e-18117373135NAC domain-containing protein 19
3swm_C1e-18117373135NAC domain-containing protein 19
3swm_D1e-18117373135NAC domain-containing protein 19
3swp_A1e-18117373135NAC domain-containing protein 19
3swp_B1e-18117373135NAC domain-containing protein 19
3swp_C1e-18117373135NAC domain-containing protein 19
3swp_D1e-18117373135NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:16103214, PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:25148240}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi02g00510.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150391e-148AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014493372.10.0NAC domain-containing protein 7
SwissprotQ9FWX28e-58NAC7_ARATH; NAC domain-containing protein 7
TrEMBLA0A1S3THY50.0A0A1S3THY5_VIGRR; NAC domain-containing protein 7
STRINGXP_007131341.11e-152(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF126933106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.12e-50NAC 007
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]