PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi02g00390.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family NAC
Protein Properties Length: 352aa    MW: 40131.6 Da    PI: 8.0454
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi02g00390.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.46.8e-5481371129
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                      +ppGfrFhPtdeel+++yLkkkv+ +k+++ +vi+evd++k+ePwdL++  ++ +  ++ewyfFs++d+ky+tg+r+nrat++g+Wkatg+dk 
  Vradi02g00390.1   8 VPPGFRFHPTDEELLHYYLKKKVSFQKFDM-DVIREVDLNKMEPWDLQErcRIGStPQNEWYFFSHKDRKYPTGSRTNRATNAGFWKATGRDKC 100
                      69****************************.99**************963433332556*********************************** PP

              NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                      + + + +++g++ktLvfykgrap+g+ktdW+mheyrle
  Vradi02g00390.1 101 IRN-SYKKIGMRKTLVFYKGRAPHGQKTDWIMHEYRLE 137
                      **9.8999****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.53E-557146IPR003441NAC domain
PROSITE profilePS5100553.1758157IPR003441NAC domain
PfamPF023654.9E-289136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048829Biological Processroot cap development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MASSNGGVPP GFRFHPTDEE LLHYYLKKKV SFQKFDMDVI REVDLNKMEP WDLQERCRIG  60
STPQNEWYFF SHKDRKYPTG SRTNRATNAG FWKATGRDKC IRNSYKKIGM RKTLVFYKGR  120
APHGQKTDWI MHEYRLEDAN DPQGSANKKN LFKIGNEGGS THNPDQQMNN SSSTNGRSFI  180
HRENHYLLHQ HQNHRNSAGL ELDKPELALH YPNLQNPQYS LFQSQTLLQT QKPMVFDYSY  240
ASSIPSDTPI MAKQLMGNPR ECESGSEGLR YQVSESGIEV GSCEPNHEVG GGRGEGINEW  300
GVLDRLVTSH LGNEESNKGV RFEEANPQSV HQINQLSLRG EMDFWAYGGK Q*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-4821369140Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator. Together with BRN1 and SMB, regulates cellular maturation of root cap. Promotes the expression of genes involved in secondary cell walls (SCW) biosynthesis. {ECO:0000269|PubMed:20197506}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00431DAPTransfer from AT4G10350Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi02g00390.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150390.0AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014493688.10.0protein BEARSKIN2
SwissprotQ9SV871e-140BRN2_ARATH; Protein BEARSKIN2
TrEMBLA0A1S3TIT30.0A0A1S3TIT3_VIGRR; protein BEARSKIN2
STRINGXP_007131322.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF87523343
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G10350.11e-137NAC domain containing protein 70
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Kamiya M, et al.
    Control of root cap maturation and cell detachment by BEARSKIN transcription factors in Arabidopsis.
    Development, 2016. 143(21): p. 4063-4072
    [PMID:27803060]