PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi0235s00070.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family NAC
Protein Properties Length: 139aa    MW: 15402.8 Da    PI: 10.7494
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi0235s00070.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM67.14.9e-218113862120
                NAM  62 skrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektd 120
                         ++d+ky++g+r nrat++gyWkatgkd++++s +++l+g+kktLvfy+grapkg++t+
  Vradi0235s00070.1  81 KTKDRKYPNGHRLNRATNHGYWKATGKDRKIKS-GSALIGMKKTLVFYTGRAPKGKRTN 138
                        5689*****************************.9**********************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100517.54417138IPR003441NAC domain
SuperFamilySSF1019413.92E-2181138IPR003441NAC domain
PfamPF023652.6E-690129IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 139 aa     Download sequence    Send to blast
MARGFGAKKM KVMRNGGGVA ACLRGEDDEN ARLVRCENLF EDGNHLYRVL DDDLIVVSQC  60
HNISRGISTL KPKPLAENCV KTKDRKYPNG HRLNRATNHG YWKATGKDRK IKSGSALIGM  120
KKTLVFYTGR APKGKRTN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-168313879134NO APICAL MERISTEM PROTEIN
1ut4_B2e-168313879134NO APICAL MERISTEM PROTEIN
1ut7_A2e-168313879134NO APICAL MERISTEM PROTEIN
1ut7_B2e-168313879134NO APICAL MERISTEM PROTEIN
3swm_A2e-168313882137NAC domain-containing protein 19
3swm_B2e-168313882137NAC domain-containing protein 19
3swm_C2e-168313882137NAC domain-containing protein 19
3swm_D2e-168313882137NAC domain-containing protein 19
3swp_A2e-168313882137NAC domain-containing protein 19
3swp_B2e-168313882137NAC domain-containing protein 19
3swp_C2e-168313882137NAC domain-containing protein 19
3swp_D2e-168313882137NAC domain-containing protein 19
4dul_A2e-168313879134NAC domain-containing protein 19
4dul_B2e-168313879134NAC domain-containing protein 19
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi0235s00070.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150362e-76AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35580.31e-27NAC transcription factor-like 9