PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi0215s00150.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family NAC
Protein Properties Length: 647aa    MW: 73490.4 Da    PI: 4.5758
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi0215s00150.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM30.69.7e-101144134
                NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevi 34
                       +p+GfrF+Ptdeelv++yLk+k+ g+++++++++
  Vradi0215s00150.1 11 MPVGFRFRPTDEELVSYYLKHKLLGDDFSVQKTF 44
                       699**********************998886654 PP

2NAM92.95.1e-293624733109
                NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk.....kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                        +G+ F+Pt++elv++yLk+k+ +++ ++ +vi+ +d+++veP+d p      +++ ++ +w+fFs+ d kya++kr nr+t++g+Wkatgkd
  Vradi0215s00150.1 362 VGVGFRPTEQELVDFYLKHKLLADDSRV-DVIPVIDLCQVEPSDVPGilaksRIRFGDPDWFFFSPVDFKYANSKRVNRKTEKGFWKATGKD 452
                        79***********************999.99**************95456555555888********************************* PP

                NAM  90 kevlsk.kgelvglkktLvfy 109
                        ++++s  +++l+ +kktL ++
  Vradi0215s00150.1 453 RDIKSWnNNTLIATKKTLRYF 473
                        ****9857777********98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.89E-9841IPR003441NAC domain
PfamPF023654.9E-71248IPR003441NAC domain
SuperFamilySSF1019414.97E-32355474IPR003441NAC domain
PROSITE profilePS5100526.96360524IPR003441NAC domain
PfamPF023652.4E-14362479IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 647 aa     Download sequence    Send to blast
MENIVSILDH MPVGFRFRPT DEELVSYYLK HKLLGDDFSV QKTFVLCRLM KKFERKHERG  60
IEAPNLPDYG NPIPAEEIPS VVDVSPRVIV DPDFPEDIFF PPEQQSPVGI DLGELFLNPS  120
PLDACFGNES SNAQIPFLDT DDEDEFVNSI WVDDEELVIN EERRHCFVNR STQPKSLRRV  180
YNASSGTDAE VVSNLHANIC SGEYSGAMSS LDSNREAHKG KKESIIQDDF WAVETSSCDS  240
TADEHIEISS SSSTRARLEN RCNPRPDNFX LQKTVAGRPQ TQKKVSNNAV SHVETRRELV  300
TVKSEKDQKN AENSSSRRIL KSRSHQSSDV NSKGSFLYME TISSNQNLFP RSCSPKSMGK  360
IVGVGFRPTE QELVDFYLKH KLLADDSRVD VIPVIDLCQV EPSDVPGILA KSRIRFGDPD  420
WFFFSPVDFK YANSKRVNRK TEKGFWKATG KDRDIKSWNN NTLIATKKTL RYFVLCRLMR  480
KSGKAIEGGT DPVVCGEEEP SELNVSDYEN QATSDEFLKD EFLKDEFLKD EFLKDEFLKD  540
EFLADENLDI EEDNTYPYLN NSFSKDINIV DSLSIYNDYF NNEEYHSSKR FKLSQDVIDD  600
ASSNQEIKKS TIIDNFCGME SSSCDSYSNE ALEINYTEIS SSQSIS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-1536347318121Stress-induced transcription factor NAC1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi0215s00150.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150421e-176AP015042.1 Vigna angularis var. angularis DNA, chromosome 9, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014521554.10.0protein CUP-SHAPED COTYLEDON 3 isoform X1
TrEMBLA0A1S3VU070.0A0A1S3VU07_VIGRR; protein CUP-SHAPED COTYLEDON 3 isoform X1
STRINGXP_007135341.11e-143(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20652586
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35580.26e-29NAC transcription factor-like 9