PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi01g14740.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family HD-ZIP
Protein Properties Length: 671aa    MW: 74042.2 Da    PI: 5.8935
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi01g14740.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.23.3e-0955862656
                     -HHHHHHH.HHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox 26 saeereeL.AkklgLterqVkvWFqNrRakek 56
                     + +++++L Ak+lgL+ +qVk+WFqNrR+++k
  Vradi01g14740.1 55 TPQQIQDLeAKRLGLENKQVKFWFQNRRTQMK 86
                     567888887999*****************999 PP

2START27.66.2e-10243325276
                      HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT- CS
            START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetl 76 
                      +a  a++elvk+a  + p+W kss    e +n de+ + f++  v      + +ea ra+gvv + +  lve+++d+  +W+e++
  Vradi01g14740.1 243 IAINAMDELVKMARQDNPLWIKSSdgrnEVLNCDEYARMFPTF-VgtkpagYLIEATRATGVVLASSLGLVETFMDVD-RWQEMF 325
                      57789*******************999999999****999774.25999*****************************.****98 PP

3START85.61.1e-27326417115206
                      EEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
            START 115 irqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                      ++ + +g+wv+vdvS+d  ++ ++s++++ +++lpSg++i++++ng sk+twveh  ++++++h+l r+lv+sg+ +ga++w a l rqce+
  Vradi01g14740.1 326 CKHHAEGVWVVVDVSIDIMRNASNSHPSMSCRRLPSGCVIQDMPNGLSKITWVEHSQYDESVIHQLCRPLVSSGIGFGAQRWIASLLRQCEC 417
                      8999**************************************************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.55E-103088IPR009057Homeodomain-like
SMARTSM003890.0084792IPR001356Homeobox domain
CDDcd000868.04E-84888No hitNo description
PfamPF000461.3E-65586IPR001356Homeobox domain
PROSITE profilePS5007110.7546488IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.5E-76495IPR009057Homeodomain-like
PROSITE profilePS5084820.977233420IPR002913START domain
CDDcd088753.82E-77237416No hitNo description
SuperFamilySSF559615.08E-17242417No hitNo description
SMARTSM002340.0037242417IPR002913START domain
PfamPF018521.5E-4243325IPR002913START domain
PfamPF018522.5E-22326417IPR002913START domain
SuperFamilySSF559612.75E-13439634No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 671 aa     Download sequence    Send to blast
MMGESFDTSN LLGRIRDDDY ESRSESDNFD GGSGDEQDVG DDQPQRKKKK YHRHTPQQIQ  60
DLEAKRLGLE NKQVKFWFQN RRTQMKTQLE RHENMVLKQE NDKLRAENGV MKEALANPIC  120
NNCGGPAIPG QISLEEHQTR IENARLKDEL NRICTLANKF LGRSLSPMAS PMSLPPTNSG  180
LELAIGRNGM GGSSNFGMPV PIGFDLGDGA LGSSPAMASM AARAPLGMMG NEIHLERSML  240
IDIAINAMDE LVKMARQDNP LWIKSSDGRN EVLNCDEYAR MFPTFVGTKP AGYLIEATRA  300
TGVVLASSLG LVETFMDVDR WQEMFCKHHA EGVWVVVDVS IDIMRNASNS HPSMSCRRLP  360
SGCVIQDMPN GLSKITWVEH SQYDESVIHQ LCRPLVSSGI GFGAQRWIAS LLRQCECLAI  420
LMTPPGPSDD PTVLSQSNRR SVLKLAQRMN EYFCSGICAS SARKWDVVHI GNLADDMKIM  480
ARKIVDDPNE APGYVLSAST CVWLPVPRQR VFDFLRNEQL RGEWDMLSKG GPMKEMLHVP  540
KGQEHGNCVS ILHYANNEGN VLYLQESWTD ASGSMVVYSP INMQSLNMMM MNTGDSSFVS  600
LRPSGFAILP DGHSNNSDNN DGGGSCLLTV GLQMVQNDNP SAKFTLESVQ TVNSLLSCTI  660
QKVKEALGVS *
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi01g14740.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150440.0AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014502466.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2-like
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A1S3U8X10.0A0A1S3U8X1_VIGRR; homeobox-leucine zipper protein ANTHOCYANINLESS 2-like
STRINGXP_007152327.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]