PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi01g14220.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family Nin-like
Protein Properties Length: 1003aa    MW: 111677 Da    PI: 6.1659
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi01g14220.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.14.2e-29592643152
           RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                      aek+isl++l++yF +++kdAAk+Lgvc+T++KriCRq+GI+RWP+Rkik++
  Vradi01g14220.1 592 AEKSISLDVLQHYFTGSLKDAAKSLGVCPTTMKRICRQHGISRWPSRKIKKV 643
                      589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.245580663IPR003035RWP-RK domain
PfamPF020424.7E-25596643IPR003035RWP-RK domain
Gene3DG3DSA:3.10.20.2402.9E-27902983No hitNo description
SMARTSM006663.1E-25902984IPR000270PB1 domain
PROSITE profilePS5174523.964902984IPR000270PB1 domain
SuperFamilySSF542771.57E-22902987No hitNo description
CDDcd064073.02E-36903983No hitNo description
PfamPF005643.8E-19903983IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0010118Biological Processstomatal movement
GO:0010167Biological Processresponse to nitrate
GO:0042128Biological Processnitrate assimilation
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1003 aa     Download sequence    Send to blast
MSESKEENPD FLPKSKPQEE HGFAMDFDIG LESLWPLDHI SSVSNPMSPF LLSTIEQPFS  60
PVWAFSDVED EKQIRIAIAG NTKAVTENPV ENYDNKKYVS PSLVAVPPSE NSDGYCLIKE  120
RMTQALRHFK ELTEQNVLAQ VWAPVRNGNR YALTTSGQPF VLDPHSNGLH QYRTVSLRYM  180
FSVDGENDEI LGLPGRVFQQ KIPEWTPNVQ YYSSKEYQRL NHAQHYNVRG TLALPVFEPA  240
GQSCVAVLEL IMTSPKINYA PEVDKICKAL ECHNVPLVRS SDPVVFSLQA VNLRSSEILE  300
HPYNQICNED RQHALAEILE ILTIVCETHS LPLAQTWVPC KHRSVLAHGG GHKKSCSSFD  360
GCCMGQVCMS ITEVAFYVID AHTWGFHEAC VEHHLQQGQG VAGRAFLSHN MCFCGNITQF  420
CKTEYPLVHY ALMFGLTSSF AVCLQSSHTG NDEYVIEFFL PPRITEFNEQ KTLLRSILAT  480
MKPHFQSLKI AAGVELEQNC SIEIIEARKE RVHLWFESIP ITQSSMSPPR HASPNMGERL  540
PLEPSEQQTT TDFDDINDGR NLGDNTDGHI DQNTSLEPRT KKKPSERKRG KAEKSISLDV  600
LQHYFTGSLK DAAKSLGVCP TTMKRICRQH GISRWPSRKI KKVNRSLSKL KCVIESVHGA  660
EGAFGLNSLS TGSLPIAAGS FSEPSTSNKF NRQTSLTIRP SEPKINEQDF DASRASETNR  720
QAGLEGQFLS TRTQNPEKVI NEKVVAIQEI GTKGTTRFRT GSGSSEESAN PSPHGSCQGS  780
PPNEMSPPKD IFVTGISEQC LVLRGSLGST LHSTSIPNHA TAYPIPNFVE TTEPQEPFGG  840
QLLEGVGSSK DLRNLCPSTD AVLEDQVPEP YRMNPQCSDL APVQHRDTNN MTPFAVRKEV  900
KNVTIKATYR EDIIRFKISL NCVIVELKEE IAKRLKLEEG TFDIKYLDDD HEWVLIACDA  960
DLQECMDISR SSGSNIIRLV VHDILPILGS SCESSGDWKC CI*
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in regulation of nitrate assimilation and in transduction of the nitrate signal. {ECO:0000269|PubMed:18826430}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00449DAPTransfer from AT4G24020Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi01g14220.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not regulated by the N source or by nitrate. {ECO:0000269|PubMed:18826430}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150440.0AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014518132.10.0protein NLP6
SwissprotQ84TH90.0NLP7_ARATH; Protein NLP7
TrEMBLA0A1S3VIU30.0A0A1S3VIU3_VIGRR; protein NLP6
STRINGXP_007152252.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42573456
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.10.0NIN like protein 7
Publications ? help Back to Top
  1. Xu N, et al.
    The Arabidopsis NRG2 Protein Mediates Nitrate Signaling and Interacts with and Regulates Key Nitrate Regulators.
    Plant Cell, 2016. 28(2): p. 485-504
    [PMID:26744214]
  2. Karve R,Suárez-Román F,Iyer-Pascuzzi AS
    The Transcription Factor NIN-LIKE PROTEIN7 Controls Border-Like Cell Release.
    Plant Physiol., 2016. 171(3): p. 2101-11
    [PMID:27221617]
  3. Yu LH, et al.
    Overexpression of Arabidopsis NLP7 improves plant growth under both nitrogen-limiting and -sufficient conditions by enhancing nitrogen and carbon assimilation.
    Sci Rep, 2016. 6: p. 27795
    [PMID:27293103]
  4. Menz J,Li Z,Schulze WX,Ludewig U
    Early nitrogen-deprivation responses in Arabidopsis roots reveal distinct differences on transcriptome and (phospho-) proteome levels between nitrate and ammonium nutrition.
    Plant J., 2016. 88(5): p. 717-734
    [PMID:27419465]
  5. Yan D, et al.
    NIN-like protein 8 is a master regulator of nitrate-promoted seed germination in Arabidopsis.
    Nat Commun, 2016. 7: p. 13179
    [PMID:27731416]
  6. Guan P, et al.
    Interacting TCP and NLP transcription factors control plant responses to nitrate availability.
    Proc. Natl. Acad. Sci. U.S.A., 2017. 114(9): p. 2419-2424
    [PMID:28202720]
  7. Liu KH, et al.
    Discovery of nitrate-CPK-NLP signalling in central nutrient-growth networks.
    Nature, 2017. 545(7654): p. 311-316
    [PMID:28489820]
  8. Li Z, et al.
    The Arabidopsis CPSF30-L gene plays an essential role in nitrate signaling and regulates the nitrate transceptor gene NRT1.1.
    New Phytol., 2017. 216(4): p. 1205-1222
    [PMID:28850721]
  9. Cao H, et al.
    Overexpression of the Maize ZmNLP6 and ZmNLP8 Can Complement the Arabidopsis Nitrate Regulatory Mutant nlp7 by Restoring Nitrate Signaling and Assimilation.
    Front Plant Sci, 2017. 8: p. 1703
    [PMID:29051766]
  10. Konishi N,Okubo T,Yamaya T,Hayakawa T,Minamisawa K
    Nitrate Supply-Dependent Shifts in Communities of Root-Associated Bacteria in Arabidopsis.
    Microbes Environ., 2017. 32(4): p. 314-323
    [PMID:29187692]
  11. Karve RA,Iyer-Pascuzzi AS
    Further insights into the role of NIN-LIKE PROTEIN 7 (NLP7) in root cap cell release.
    Plant Signal Behav, 2018. 13(1): p. e1414122
    [PMID:29215953]
  12. Zhao L, et al.
    The Arabidopsis NLP7 gene regulates nitrate signaling via NRT1.1-dependent pathway in the presence of ammonium.
    Sci Rep, 2018. 8(1): p. 1487
    [PMID:29367694]