PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi01g13890.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 366aa    MW: 40657.7 Da    PI: 9.6015
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi01g13890.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.57.4e-096199141
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqck 41
                     r +WT+ E++++++a +++  + Wk+I + +g  +t  q+k
  Vradi01g13890.1 61 RENWTEPEHDKFLEALQLFDRD-WKKIEAFVG-SKTVIQLK 99
                     789*****************77.*********.***99998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.61E-1048100IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-95999IPR006447Myb domain, plants
PROSITE profilePS5129310.7759113IPR017884SANT domain
SMARTSM007171.2E-460108IPR001005SANT/Myb domain
PfamPF002492.4E-66199IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-46199IPR009057Homeodomain-like
CDDcd001671.68E-56399No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MVSKNPNPPE GFYLDPTVMA LPGMPPFASV SAAAAAAVSA SNSSDDAAKK IRKPYTITKS  60
RENWTEPEHD KFLEALQLFD RDWKKIEAFV GSKTVIQLKY AISHFLVKFS VLNFLGWESI  120
DPRLEKAYAQ LKIWAQIRSH AQKYFLKVQK SGASEHLPPP RPKRKAAHPY PQKASRNAPV  180
LPQVSGSFQS SSSLLEPGYI LKNDSPAMLK IPMNTVVSSW SNNTLQTVNL SPVTKVNNPC  240
SSGESTPKVR PAVESHGQGP HQGNKIHPLR GKVLPDFTQV YGFIGSVFDP NATEHLQKLK  300
KMDRIDVETV LLLMRNLSIN LTSPDFEDHV SIYVPELMER HKVEMLESQL NFYPALGSYC  360
CCSSL*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi01g13890.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027923153.10.0protein REVEILLE 6-like
SwissprotQ8H0W31e-104RVE6_ARATH; Protein REVEILLE 6
TrEMBLA0A4D6M1K80.0A0A4D6M1K8_VIGUN; Transcription factor
STRINGGLYMA16G29740.11e-170(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11193396
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.12e-82MYB_related family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL
    The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size.
    Plant Physiol., 2017. 173(4): p. 2308-2322
    [PMID:28254761]