PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi01g09700.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family NAC
Protein Properties Length: 336aa    MW: 38168.9 Da    PI: 6.8553
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi01g09700.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM182.11.3e-56171441129
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrFhPtdee++++yL++kv ++ +++ ++i e+d++k+ePwdLpkk+k +ek+wyfF++rd+ky+tg r+nrat+sgyWkatgkdke+++
  Vradi01g09700.1  17 LPPGFRFHPTDEEIITCYLTEKVLDRGFSA-TAIGEADLNKCEPWDLPKKAKMGEKDWYFFCQRDRKYPTGLRTNRATQSGYWKATGKDKEIFK 109
                      79**************************99.88***************99999***************************************** PP

              NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrle 129
                       k++lvg+kktLvfy+grapkgekt+Wvmhe+rle
  Vradi01g09700.1 110 GKNNLVGMKKTLVFYRGRAPKGEKTNWVMHEFRLE 144
                      99******************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.31E-6214168IPR003441NAC domain
PROSITE profilePS5100558.19817168IPR003441NAC domain
PfamPF023652.9E-2918143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MMEEPVVVNK GDEPLDLPPG FRFHPTDEEI ITCYLTEKVL DRGFSATAIG EADLNKCEPW  60
DLPKKAKMGE KDWYFFCQRD RKYPTGLRTN RATQSGYWKA TGKDKEIFKG KNNLVGMKKT  120
LVFYRGRAPK GEKTNWVMHE FRLEGKFACY NLPKAAKDEW VVCKVFHKSN TDVNKRVLPI  180
NPGIGLLRMN SIGEDLFDFS SLPPLVDPLF DQTSHNKHID NDFKGNFNSN NNPMGIGTSN  240
HNPLQNTISP FNVFQDYYIH QGKNSFQQCK KEQFSNTVVS ASQDTCLSND RNTDTSSVVS  300
KQDNMGRNKA LYEDLDQAPS SVATLSDLDC LWDDY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A2e-511517118171NAC domain-containing protein 19
3swm_B2e-511517118171NAC domain-containing protein 19
3swm_C2e-511517118171NAC domain-containing protein 19
3swm_D2e-511517118171NAC domain-containing protein 19
3swp_A2e-511517118171NAC domain-containing protein 19
3swp_B2e-511517118171NAC domain-containing protein 19
3swp_C2e-511517118171NAC domain-containing protein 19
3swp_D2e-511517118171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00518DAPTransfer from AT5G18270Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi01g09700.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU6619220.0EU661922.1 Glycine max NAC domain protein (NAC23) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027923069.10.0NAC domain-containing protein 87-like
SwissprotQ9FK441e-118NAC87_ARATH; NAC domain-containing protein 87
TrEMBLA0A4D6LZC70.0A0A4D6LZC7_VIGUN; Uncharacterized protein
STRINGXP_007151811.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40934171
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18270.11e-119Arabidopsis NAC domain containing protein 87
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]