PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi01g09670.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family NAC
Protein Properties Length: 166aa    MW: 18844.7 Da    PI: 10.3196
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi01g09670.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.53e-5491391128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrFhPtdeel+ +yL+kkv++ +l++ ++i+evdiyk++Pw+Lp+k++ +ekewyfFs+rd+ky++g r+nra++sgyWkatg+dk++++
  Vradi01g09670.1   9 LPPGFRFHPTDEELILHYLRKKVASIPLPV-SIIAEVDIYKCDPWELPAKAAFGEKEWYFFSPRDRKYPNGARPNRAAASGYWKATGTDKNIVA 101
                      79****************************.89***************988899**************************************** PP

              NAM  95 k....kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      +     +e+ g+kk Lvfykg+ pkg+kt+W+mheyrl
  Vradi01g09670.1 102 SlgggVREHFGVKKALVFYKGKPPKGVKTNWIMHEYRL 139
                      998776677***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-605144IPR003441NAC domain
PROSITE profilePS5100555.7869162IPR003441NAC domain
PfamPF023651.4E-2810139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 166 aa     Download sequence    Send to blast
MGTPQSNNLP PGFRFHPTDE ELILHYLRKK VASIPLPVSI IAEVDIYKCD PWELPAKAAF  60
GEKEWYFFSP RDRKYPNGAR PNRAAASGYW KATGTDKNIV ASLGGGVREH FGVKKALVFY  120
KGKPPKGVKT NWIMHEYRLV DTNKPVRIKD TSMRVSFPIY FHHNN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A2e-63814419150NAC domain-containing protein 19
3swm_B2e-63814419150NAC domain-containing protein 19
3swm_C2e-63814419150NAC domain-containing protein 19
3swm_D2e-63814419150NAC domain-containing protein 19
3swp_A2e-63814419150NAC domain-containing protein 19
3swp_B2e-63814419150NAC domain-containing protein 19
3swp_C2e-63814419150NAC domain-containing protein 19
3swp_D2e-63814419150NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to the promoter of ACO5, an ACC oxidase involved in ethylene biosynthesis. Mediates waterlogging-induced hyponastic leaf movement, and cell expansion in abaxial cells of the basal petiole region, by directly regulating the expression of ACO5 (PubMed:24363315). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000269|PubMed:24363315}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi01g09670.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By root flooding (PubMed:24363315). Induced by senescence (PubMed:24659488). {ECO:0000269|PubMed:24363315, ECO:0000269|PubMed:24659488}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150441e-166AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014517325.11e-112NAC transcription factor 47
SwissprotQ84TD66e-82NAC47_ARATH; NAC transcription factor 47
TrEMBLA0A1S3VGC11e-111A0A1S3VGC1_VIGRR; NAC transcription factor 47
STRINGXP_007151816.11e-109(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF66212750
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04070.21e-84NAC domain containing protein 47
Publications ? help Back to Top
  1. Hofmann NR
    A NAC transcription factor for flooding: SHYG helps plants keep their leaves in the air.
    Plant Cell, 2013. 25(12): p. 4771
    [PMID:24363314]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]