PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi01g06980.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family bHLH
Protein Properties Length: 244aa    MW: 28115.7 Da    PI: 7.0292
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi01g06980.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH46.66.1e-1572124155
                      CHHHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
              HLH   1 rrrahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55 
                      +++ h+e+Er+RR+++ ++++ Lr+llP ++   ++K s ++   +Av+YIk++q
  Vradi01g06980.1  72 KKMIHKEIERQRRQEMATCYASLRSLLPLQF--IKGKRSISDHMNEAVNYIKHMQ 124
                      5788*************************65..*********************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF474592.62E-1468141IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000836.28E-1171128No hitNo description
PROSITE profilePS5088814.01171123IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000104.8E-1272124IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.106.8E-1273144IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003533.2E-677129IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MFPFQRGNEL VIQFSNSPHH HQQHEISQQD LILDDYASLD DNLSGKNFSR TQSENLFYEP  60
NKKNHDSNEH MKKMIHKEIE RQRRQEMATC YASLRSLLPL QFIKGKRSIS DHMNEAVNYI  120
KHMQNNIKEL VAKRDELKKL SNHSNMENSH EGLHTSCNFT VHENNDIIGI EITSGFIEER  180
PKVSKLLQLL IQEGLEVVSC LSSEVNGRLL HSVQCEVNSS NCVDLSELRR KISKAFPAFR  240
CSD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150441e-180AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014510613.11e-180PREDICTED: transcription factor bHLH118-like
TrEMBLA0A0L9VIT91e-175A0A0L9VIT9_PHAAN; Uncharacterized protein
STRINGGLYMA16G32620.11e-134(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF79233125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G51780.18e-42bHLH family protein