PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi01g05500.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family G2-like
Protein Properties Length: 418aa    MW: 46396.8 Da    PI: 6.7653
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi01g05500.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.13.6e-32245298255
          G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Vradi01g05500.1 245 PRMRWTSSLHNRFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 298
                      9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.16E-15242299IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.1E-29243299IPR009057Homeodomain-like
TIGRFAMsTIGR015576.5E-24245298IPR006447Myb domain, plants
PfamPF002493.0E-7246297IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 418 aa     Download sequence    Send to blast
MPQNSIFRDQ SSNQIPDLSL HISLPNSAPS SICTGGDSPF DTWPQQADED DYAQGFKSHS  60
DGSIKGCSPY HTDTQLSLAN STTSVTATPS EADSTWRKRN FVRLSHHHGA SEGQIRLING  120
IPLYSNLSSL DNTSTAPSIE RTPTNKFSFP SLYSLPHPPY SANSAPNYSY NGAVGGVAAE  180
PISRFHDITM ENTPRPQQFQ YFDYPQQQQQ FGNSTNFGTS EFSNGFVRSR MLPRQQSSKR  240
NMRAPRMRWT SSLHNRFVHA VELLGGHERA TPKSVLELMD VKDLTLAHVK SHLQMYRTVK  300
NTDKPAPSSD GDEDFMSITV PNNQNKNFLP NQRGAPNASL DHDMGHTSRN LWANSSTSRG  360
ARIQGSEHDL EELSPEEILA SQHSGKFSEG NNNFTQTRSF KDQNPSLEFT LGRSTEE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A3e-17246300458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B3e-17246300458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A3e-17246300357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-17246300357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-17246300357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-17246300357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A3e-17246300458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C3e-17246300458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D3e-17246300458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F3e-17246300458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H3e-17246300458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J3e-17246300458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi01g05500.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150440.0AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014520269.10.0probable transcription factor KAN4 isoform X1
TrEMBLA0A1S3VQC00.0A0A1S3VQC0_VIGRR; probable transcription factor KAN4 isoform X1
STRINGGLYMA07G12070.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17563391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.15e-46G2-like family protein