PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi01g01860.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family NAC
Protein Properties Length: 335aa    MW: 38201.6 Da    PI: 5.966
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi01g01860.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1806.1e-56221481129
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrFhPtdeel+++yL +kv ++ +   ++i e+d++k+ePwdLp ++k +ekewyfFs rd+ky+tg+r+nrat +gyWkatgkdke+++
  Vradi01g01860.1  22 LPPGFRFHPTDEELITHYLSQKVLDNCFCS-RAIGEADLNKCEPWDLPCMAKMGEKEWYFFSVRDRKYPTGQRTNRATGAGYWKATGKDKEIYK 114
                      79************************9877.89***************8888899*************************************** PP

              NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrle 129
                        ++l+g+kktLvfykgrap+gekt+Wvmheyrle
  Vradi01g01860.1 115 -ARTLIGMKKTLVFYKGRAPSGEKTNWVMHEYRLE 148
                      .899*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.45E-6315172IPR003441NAC domain
PROSITE profilePS5100558.99122172IPR003441NAC domain
PfamPF023656.5E-3023147IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MDAMENYYYS QRDTMAEEAF DLPPGFRFHP TDEELITHYL SQKVLDNCFC SRAIGEADLN  60
KCEPWDLPCM AKMGEKEWYF FSVRDRKYPT GQRTNRATGA GYWKATGKDK EIYKARTLIG  120
MKKTLVFYKG RAPSGEKTNW VMHEYRLEDH HSMHNPHKKA MNDWAICRIF EKTNCGKKMQ  180
ISGLVRLSSF GKEMPSLMDS SPYNTTEAKP VLGESSQFSS DRNQSDENIA ESLETLMMAS  240
SSSYSSNPFD VSPASWSVPH QSLQAGNSNY SMDEEQQSML GMVIENHGSS TTLRTHKALN  300
NDFDADTSSF IYNDEIFHRS FGNQEYSSPS LWGF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A3e-562017818174NAC domain-containing protein 19
3swm_B3e-562017818174NAC domain-containing protein 19
3swm_C3e-562017818174NAC domain-containing protein 19
3swm_D3e-562017818174NAC domain-containing protein 19
3swp_A3e-562017818174NAC domain-containing protein 19
3swp_B3e-562017818174NAC domain-containing protein 19
3swp_C3e-562017818174NAC domain-containing protein 19
3swp_D3e-562017818174NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi01g01860.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150440.0AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014509002.10.0NAC domain-containing protein 100
SwissprotQ9FLJ21e-106NC100_ARATH; NAC domain-containing protein 100
TrEMBLA0A1S3USQ00.0A0A1S3USQ0_VIGRR; NAC domain-containing protein 100
STRINGXP_007151241.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40934171
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.11e-107NAC domain containing protein 100
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]