PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi01g01810.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family NAC
Protein Properties Length: 373aa    MW: 42610.1 Da    PI: 6.9246
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi01g01810.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.99.6e-54141402128
              NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      +pGfrFhPtdeelv +yLk+k+++k+l++ e ik+vdiyk++PwdLp + + ++ekewyf+++rd+ky+++ r+nr+t++g+Wkatg+d++++s
  Vradi01g01810.1  14 MPGFRFHPTDEELVGFYLKRKIQQKSLPI-ELIKQVDIYKHDPWDLPkELAGTGEKEWYFYCPRDRKYRNSARPNRVTRAGFWKATGTDRPIYS 106
                      79***************************.89***************445566899************************************** PP

              NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      ++g+ +glkk+Lvfy+gra kg ktdW+mhe+rl
  Vradi01g01810.1 107 SEGKCIGLKKSLVFYRGRAAKGMKTDWMMHEFRL 140
                      ********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-5611171IPR003441NAC domain
PROSITE profilePS5100555.80413171IPR003441NAC domain
PfamPF023654.0E-2615140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
MEERNEMEKI DDVMPGFRFH PTDEELVGFY LKRKIQQKSL PIELIKQVDI YKHDPWDLPK  60
ELAGTGEKEW YFYCPRDRKY RNSARPNRVT RAGFWKATGT DRPIYSSEGK CIGLKKSLVF  120
YRGRAAKGMK TDWMMHEFRL PCMSDSAPTK KLSDKTLPPS DSWAICRIFK KTNSLSMAQK  180
ALSHPWISQL SGSMVSDMFT QGAETNHHLG SPAIQFCYEK QELNQVSNSD INTNFTASDI  240
PSYKPINSST VPKPSPQIPV SDDFIFYTEH TKCTLDATSM LSPNPDYITF EEPNQQQYSG  300
FSTNLPHFIQ QNMTTETVTK EQEDWETIGR TTGFPFTLLP PYDAWKPSSV AWDSPSCPSD  360
MSTTYSTSKC YT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-5211743171Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPromotes periclinal root capforming cell divisions. Activates expression of its negative regulator SMB in a feedback loop for controlled switches in cell division plane. {ECO:0000269|PubMed:19081078}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi01g01810.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by SMB in oriented-divised root cap stem cells. {ECO:0000269|PubMed:19081078}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150440.0AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022631906.10.0protein FEZ isoform X1
SwissprotQ9FIW51e-92NAC94_ARATH; Putative NAC domain-containing protein 94
SwissprotQ9ZVH09e-92FEZ_ARATH; Protein FEZ
TrEMBLA0A3Q0ELE50.0A0A3Q0ELE5_VIGRR; protein FEZ isoform X1
STRINGXP_007151225.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20133490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39820.14e-95NAC domain containing protein 94
Publications ? help Back to Top
  1. Bennett T,van den Toorn A,Willemsen V,Scheres B
    Precise control of plant stem cell activity through parallel regulatory inputs.
    Development, 2014. 141(21): p. 4055-64
    [PMID:25256342]