PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi01g01680.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family HD-ZIP
Protein Properties Length: 232aa    MW: 26569.7 Da    PI: 7.5859
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi01g01680.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.72e-183587456
                     -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox  4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                     + +++ eq+++Le+ Fe  +++  e++ +LAk lgL+ rq+ +WFqNrRa++k
  Vradi01g01680.1 35 KKRLSLEQVKALEKSFELGNKLEPERKMQLAKALGLQPRQIAIWFQNRRARWK 87
                     556899**********************************************9 PP

2HD-ZIP_I/II129.51.4e-4133125193
      HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                      ekk+rls eqvk+LE+sFe  +kLeperK++la++Lglqprq+a+WFqnrRAR+ktkqlEk+ye+Lk++++a+k++n++L++++++L++el++
  Vradi01g01680.1  33 EKKKRLSLEQVKALEKSFELGNKLEPERKMQLAKALGLQPRQIAIWFQNRRARWKTKQLEKEYEVLKKQFEAVKADNDSLKAQNQKLHAELQS 125
                      69***************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.07E-192591IPR009057Homeodomain-like
PROSITE profilePS5007117.1512989IPR001356Homeobox domain
SMARTSM003894.6E-183293IPR001356Homeobox domain
CDDcd000864.41E-153490No hitNo description
PfamPF000461.2E-153587IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.4E-193691IPR009057Homeodomain-like
PRINTSPR000317.2E-66069IPR000047Helix-turn-helix motif
PROSITE patternPS0002706487IPR017970Homeobox, conserved site
PRINTSPR000317.2E-66985IPR000047Helix-turn-helix motif
PfamPF021832.5E-1589129IPR003106Leucine zipper, homeobox-associated
Gene3DG3DSA:1.20.5.1709.8E-492127No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MMKRSMSFSG IENKCDEVHG DDELSDDGSQ LGEKKKRLSL EQVKALEKSF ELGNKLEPER  60
KMQLAKALGL QPRQIAIWFQ NRRARWKTKQ LEKEYEVLKK QFEAVKADND SLKAQNQKLH  120
AELQSLKNRD CCETGTVVSH KKDTEGSWSN GSNNSSEINL DLSRTPVMNS PVSSQNGKSL  180
LPTSHKPTTM TQLLQSSSRS DLQDESFCNM FHNIDEQQNF WPWTEQQHQF H*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18189RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi01g01680.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin. {ECO:0000269|PubMed:12644682}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150440.0AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014517181.11e-170homeobox-leucine zipper protein HAT7-like
SwissprotQ8LAT07e-72ATB20_ARATH; Homeobox-leucine zipper protein ATHB-20
TrEMBLA0A1S3VFP61e-169A0A1S3VFP6_VIGRR; homeobox-leucine zipper protein HAT7-like
STRINGXP_007151217.11e-146(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127133106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01220.11e-65homeobox protein 20