PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi0153s00450.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family LBD
Protein Properties Length: 124aa    MW: 13605.9 Da    PI: 8.0324
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi0153s00450.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260134.54.1e-4271061100
             DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                        +Ca+Ck+lrr+C++dC++apyfp+++  kfa+vhk+FG sn++k+lk++p e+r da++slvyeA+ar+ +PvyG+vg+i+kl+ q+++l+ 
  Vradi0153s00450.1   7 PCASCKLLRRRCSPDCIFAPYFPSNDLCKFAIVHKVFGCSNITKILKNVPVEQRGDAVRSLVYEANARIINPVYGCVGIISKLETQVSELQM 98 
                        7******************************************************************************************* PP

             DUF260  93 elallkee 100
                        +la+++ee
  Vradi0153s00450.1  99 QLAVVEEE 106
                        ***99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.1346107IPR004883Lateral organ boundaries, LOB
PfamPF031955.6E-427104IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 124 aa     Download sequence    Send to blast
MGGTSSPCAS CKLLRRRCSP DCIFAPYFPS NDLCKFAIVH KVFGCSNITK ILKNVPVEQR  60
GDAVRSLVYE ANARIINPVY GCVGIISKLE TQVSELQMQL AVVEEEILSI KMQQEFIFTN  120
GST*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150361e-109AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014489817.13e-87PREDICTED: LOB domain-containing protein 12-like
SwissprotQ8LBW36e-57LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A0L9UWX93e-84A0A0L9UWX9_PHAAN; Uncharacterized protein
STRINGVIT_13s0067g01880.t018e-57(Vitis vinifera)
STRINGGLYMA18G02780.16e-57(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16643497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.14e-58LBD family protein