PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi0122s00300.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family HD-ZIP
Protein Properties Length: 691aa    MW: 76371.4 Da    PI: 6.4054
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi0122s00300.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.92.6e-21121176156
                        TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        +++ +++t++q++eLe+lF+++++p++++r eL+++l+L++rqVk+WFqNrR+++k
  Vradi0122s00300.1 121 KKRYHRHTPQQIQELEALFKECPHPDEKQRLELSRRLNLETRQVKFWFQNRRTQMK 176
                        688999***********************************************999 PP

2START207.36e-653325561206
                        HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EE CS
              START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....ka 79 
                        ela++a++elvk+a+ +ep+W +s     e++n++e++++ ++  +     + +ea+r +g+v+ ++  lve+l+d++ +W+e+++    + 
  Vradi0122s00300.1 332 ELALAAMDELVKMAQTGEPLWIRSLeggrEILNYEEYTRTMTPCIGlrpngFVTEASRQTGMVIINSLALVETLMDSN-RWSEMFPcmiaRT 422
                        5899*************************************999989**99***************************.************* PP

                        EEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEE CS
              START  80 etlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskv 164
                        +t evis+g      galqlm aelq+lsplvp R++ f+R+++q+ +g w++vdvS+d  ++ +  + +v +++lpSg+++++++ng+skv
  Vradi0122s00300.1 423 STAEVISNGingtrnGALQLMHAELQVLSPLVPvREVNFLRFCKQHAEGLWAVVDVSIDTIRETSGAPTFVNCRRLPSGCVVQDMPNGYSKV 514
                        ***************************************************************999************************** PP

                        EEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
              START 165 twvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                        twveh++++++++h+l+r+l++sg+ +ga++wvatlqrqce+
  Vradi0122s00300.1 515 TWVEHAEYDESQVHQLYRPLLSSGTGFGAQRWVATLQRQCEC 556
                        ****************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.63E-21104178IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-21108172IPR009057Homeodomain-like
PROSITE profilePS5007117.75118178IPR001356Homeobox domain
SMARTSM003891.1E-19119182IPR001356Homeobox domain
CDDcd000863.48E-19120178No hitNo description
PfamPF000466.5E-19121176IPR001356Homeobox domain
PROSITE patternPS000270153176IPR017970Homeobox, conserved site
PROSITE profilePS5084844.868323559IPR002913START domain
SuperFamilySSF559616.59E-35326556No hitNo description
CDDcd088756.06E-128327555No hitNo description
SMARTSM002346.5E-48332556IPR002913START domain
PfamPF018523.2E-56332556IPR002913START domain
SuperFamilySSF559612.42E-10577666No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 691 aa     Download sequence    Send to blast
MSFGGFLEVK QSGGGGRIVS DIPYSNGSNH SNDIMPSGAI SQPRLASPTL AKSMFNSPGL  60
SLALQSDVDG QGDMNRLMPE NFEQNGLRRS REEEHESRSG SDNMDGASGD DFDAADNPPR  120
KKRYHRHTPQ QIQELEALFK ECPHPDEKQR LELSRRLNLE TRQVKFWFQN RRTQMKTQLE  180
RHENSLLRQE NDKLRAENMS MREAMRNPMC SNCGGPAMIG EISLEEQHLR IENARLKDEL  240
DRVCALAGKF LGRPISSLTS SIGPPLPNSS LELGVGSNGF GGLSTVPSTL PDFGVGISSP  300
LAMMSASTRP TATSTVVTGG LDRSVERSIV LELALAAMDE LVKMAQTGEP LWIRSLEGGR  360
EILNYEEYTR TMTPCIGLRP NGFVTEASRQ TGMVIINSLA LVETLMDSNR WSEMFPCMIA  420
RTSTAEVISN GINGTRNGAL QLMHAELQVL SPLVPVREVN FLRFCKQHAE GLWAVVDVSI  480
DTIRETSGAP TFVNCRRLPS GCVVQDMPNG YSKVTWVEHA EYDESQVHQL YRPLLSSGTG  540
FGAQRWVATL QRQCECLAIL MSSAVPSREH SAISSGGRRS MLKLAQRMTN NFCAGVCAST  600
VHKWNKLNAG NVGEDVRVMT RKSVDDPGEP PGIVLSAATS VWLPVSPQRL FDFLRDERLR  660
SEWDILSNGE IEKDRVGNFG SIYEDNWHQK *
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi0122s00300.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0311660.0KT031166.1 Glycine max clone HN_CCL_121 homeodomain/HOMEOBOX transcription factor (Glyma09g40130.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014490274.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2
RefseqXP_014490275.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A1S3T9400.0A0A1S3T940_VIGRR; homeobox-leucine zipper protein ANTHOCYANINLESS 2
STRINGXP_007139955.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]