PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi0051s00540.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family NAC
Protein Properties Length: 517aa    MW: 59387.6 Da    PI: 6.1281
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi0051s00540.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM124.87.4e-39781891116
                NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                        lppGfrFhPtd+elv++yL++k++g+++ +  +ikevd+yk++Pw+Lp+    +ekewyfFs+rd+ky++g+r+nra+ sgyWkatg dk++
  Vradi0051s00540.1  78 LPPGFRFHPTDDELVNHYLCRKCAGQPIAV-PIIKEVDLYKFDPWQLPEIGFYGEKEWYFFSPRDRKYPNGSRPNRAAGSGYWKATGADKPI 168
                        79**************************99.88***************54445789************************************ PP

                NAM  93 lskkgelvglkktLvfykgrapkg 116
                         +   ++ g+kk L +   +apk+
  Vradi0051s00540.1 169 GK--PKALGIKKALKYN-TEAPKA 189
                        98..778********98.566654 PP

2NAM107.12.2e-332973956107
                NAM   6 rFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                         FhPtd+elv++yL++k++g+++ +  +ikevd+yk++Pw+Lp+    +ekewyfFs+rd+ky++g+r+nra+ sgyWkatg dk++ +   
  Vradi0051s00540.1 297 MFHPTDDELVNHYLCRKCAGQPIAV-PIIKEVDLYKFDPWQLPEIGFYGEKEWYFFSPRDRKYPNGSRPNRAAGSGYWKATGADKPIGK--P 385
                        6**********************99.88***************54445789************************************98..6 PP

                NAM  98 elvglkktLv 107
                        ++ g+kk L 
  Vradi0051s00540.1 386 KALGIKKALK 395
                        7799999885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.45E-4372186IPR003441NAC domain
PROSITE profilePS5100539.63678227IPR003441NAC domain
PfamPF023651.8E-1979185IPR003441NAC domain
PROSITE profilePS5100534.126292435IPR003441NAC domain
PfamPF023651.4E-14297395IPR003441NAC domain
SuperFamilySSF1019412.35E-36298394IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 517 aa     Download sequence    Send to blast
RTCEIRFVFF RSSLYKTHTS DPLPHVSSHI AKQSQQHSPT KTTTTAETKE ARKSEYRSVN  60
ETTHKREDKK RMKGELELPP GFRFHPTDDE LVNHYLCRKC AGQPIAVPII KEVDLYKFDP  120
WQLPEIGFYG EKEWYFFSPR DRKYPNGSRP NRAAGSGYWK ATGADKPIGK PKALGIKKAL  180
KYNTEAPKAE TRMVYNFEHE TKPVIEKLGN EQLFIDSSDS MHRLQSESSG SEQVVSSDMR  240
WEREVQSQPK WNDIGLQLEN AFDFQYNYFD NDNLSVDDPF GSVEYPLQDV LIEALLMFHP  300
TDDELVNHYL CRKCAGQPIA VPIIKEVDLY KFDPWQLPEI GFYGEKEWYF FSPRDRKYPN  360
GSRPNRAAGS GYWKATGADK PIGKPKALGI KKALKGKIEK YNTGAPKSET GVVYNFEHET  420
KPVIEKLGNE QLFMDSSDSM QRLQSESSGS EQVVSPDVRW EREVQSQPKW NDIGLQLENA  480
FDFQYNYFDS NNLSVDDPFG SVEYPLQDVL IEALLM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A6e-557339410128Stress-induced transcription factor NAC1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapVradi0051s00540.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150351e-162AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014524509.11e-150NAC domain-containing protein 2-like
SwissprotQ390134e-69NAC2_ARATH; NAC domain-containing protein 2
TrEMBLA0A1S3W2X41e-148A0A1S3W2X4_VIGRR; NAC domain-containing protein 2-like
STRINGXP_007137752.11e-129(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2860823
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.17e-66NAC family protein
Publications ? help Back to Top
  1. Florentin A,Damri M,Grafi G
    Stress induces plant somatic cells to acquire some features of stem cells accompanied by selective chromatin reorganization.
    Dev. Dyn., 2013. 242(10): p. 1121-33
    [PMID:23798027]
  2. Jensen MK, et al.
    ATAF1 transcription factor directly regulates abscisic acid biosynthetic gene NCED3 in Arabidopsis thaliana.
    FEBS Open Bio, 2013. 3: p. 321-7
    [PMID:23951554]
  3. Wang YX
    Characterization of a novel Medicago sativa NAC transcription factor gene involved in response to drought stress.
    Mol. Biol. Rep., 2013. 40(11): p. 6451-8
    [PMID:24057250]
  4. Yang X, et al.
    Overexpression of a Miscanthus lutarioriparius NAC gene MlNAC5 confers enhanced drought and cold tolerance in Arabidopsis.
    Plant Cell Rep., 2015. 34(6): p. 943-58
    [PMID:25666276]
  5. Du Q,Wang H
    The role of HD-ZIP III transcription factors and miR165/166 in vascular development and secondary cell wall formation.
    Plant Signal Behav, 2015. 10(10): p. e1078955
    [PMID:26340415]
  6. Takasaki H, et al.
    SNAC-As, stress-responsive NAC transcription factors, mediate ABA-inducible leaf senescence.
    Plant J., 2015. 84(6): p. 1114-23
    [PMID:26518251]
  7. Liu Y,Sun J,Wu Y
    Arabidopsis ATAF1 enhances the tolerance to salt stress and ABA in transgenic rice.
    J. Plant Res., 2016. 129(5): p. 955-962
    [PMID:27216423]
  8. Ghandchi FP,Caetano-Anolles G,Clough SJ,Ort DR
    Investigating the Control of Chlorophyll Degradation by Genomic Correlation Mining.
    PLoS ONE, 2016. 11(9): p. e0162327
    [PMID:27618630]
  9. Zhao J,Missihoun TD,Bartels D
    The ATAF1 transcription factor is a key regulator of aldehyde dehydrogenase 7B4 (ALDH7B4) gene expression in Arabidopsis thaliana.
    Planta, 2018. 248(4): p. 1017-1027
    [PMID:30027414]