PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang11g16770.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family ARR-B
Protein Properties Length: 616aa    MW: 66898.6 Da    PI: 6.5563
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang11g16770.2genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like48.71.6e-151471772555
         G2-like  25 ekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      kA+Pk+ilelm+v+gLt+e+v+SHLQkYRl
  Vang11g16770.2 147 GKAVPKKILELMNVPGLTRENVASHLQKYRL 177
                     59****************************8 PP

2Response_reg56.61.5e-194212725109
                     EEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTESEEEESS--HHHHHH CS
    Response_reg  25 evaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGakdflsKpfdpeelvk 109
                     +v+ +  +e al ll+e++  +D+++ D+ mp+mdG++ll++i  e  +lp+i+++a + ++ + + +  Ga d+l Kp+ +e+l +
  Vang11g16770.2  42 SVTKCNRAETALSLLRENKngFDIVISDVHMPDMDGFKLLEHIGLEM-DLPVIMMSADDGKSVVMKGVTHGACDYLIKPVRIEALKN 127
                     466677788899999888778**********************6654.8**********************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23004.1E-3223144No hitNo description
SuperFamilySSF521724.27E-2923140IPR011006CheY-like superfamily
SMARTSM004481.1E-2124129IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011030.38925133IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.9E-1626127IPR001789Signal transduction response regulator, receiver domain
CDDcd001562.24E-2227132No hitNo description
SuperFamilySSF466897.88E-9146181IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.7E-15147182IPR009057Homeodomain-like
TIGRFAMsTIGR015573.3E-13148177IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 616 aa     Download sequence    Send to blast
MSTVTTTGVM KSGDVVSNQF PAGLRVLVVD DDPTSFVLVV VSVTKCNRAE TALSLLRENK  60
NGFDIVISDV HMPDMDGFKL LEHIGLEMDL PVIMMSADDG KSVVMKGVTH GACDYLIKPV  120
RIEALKNIWQ HVVRKKKNEW KDAEQSGKAV PKKILELMNV PGLTRENVAS HLQKYRLYLR  180
RLSGVSQHQN NMNNSFLGSQ EATFGTISSI SGIDLQTLAV AGQLPAQSLA TLQAAGLGRS  240
TAKAGVPMPI MDQRNLFSFE NPRVRFGEGQ QQHLSSSKPM NLLLGIPTNM EPKQLANLHQ  300
STQSIASLNM RVNASAPQGN PLLMQMPQSQ PRGQMLSENT GPRVPRLPSS LGQPNVSNGI  360
SNGFLGRNGI AGNNRGPAYN PVPPNSSLLS FPMNQSSEMS VNNSLPLGST PGMSSITTKG  420
SFQEEVTSGI KTSGGFPSYD IFNELHHHKS HDWEITNPGL TYSAPHHANP LQGNIDVSPS  480
VLVHQGFSST QQTGQSRDAT LIGKSMFSVG QGSEQDNLQN AVQHLHPLLV DNSVRVKSER  540
IPDASSQTNL FPDHYGQEDL MSALLKQVCP SSLSLDLEYL HQEGMGPAES EFEFDAYSLD  600
NIPDLVGVKY SDFWE*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. Could directly activate some type-A response regulators in response to cytokinins. Regulates SHY2 by binding to its promoter (PubMed:19039136). Involved in the root-meristem size determination through the regulation of cell differentiation (PubMed:17363254). {ECO:0000269|PubMed:11574878, ECO:0000269|PubMed:11691951, ECO:0000269|PubMed:17363254, ECO:0000269|PubMed:19039136}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang11g16770.2
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Down-regulated by gibberellin. {ECO:0000269|PubMed:20605455}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017405931.10.0PREDICTED: two-component response regulator ARR2-like
RefseqXP_017405938.10.0PREDICTED: two-component response regulator ARR2-like
RefseqXP_017405944.10.0PREDICTED: two-component response regulator ARR2-like
SwissprotQ940D04e-83ARR1_ARATH; Two-component response regulator ARR1
TrEMBLA0A445K1070.0A0A445K107_GLYSO; Two-component response regulator
STRINGXP_007154337.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39583458
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16857.23e-85response regulator 1
Publications ? help Back to Top
  1. Bürkle L,Meyer S,Dortay H,Lehrach H,Heyl A
    In vitro recombination cloning of entire cDNA libraries in Arabidopsis thaliana and its application to the yeast two-hybrid system.
    Funct. Integr. Genomics, 2005. 5(3): p. 175-83
    [PMID:15714319]
  2. Moubayidin L, et al.
    Spatial coordination between stem cell activity and cell differentiation in the root meristem.
    Dev. Cell, 2013. 26(4): p. 405-15
    [PMID:23987513]
  3. Takahashi N, et al.
    Cytokinins control endocycle onset by promoting the expression of an APC/C activator in Arabidopsis roots.
    Curr. Biol., 2013. 23(18): p. 1812-7
    [PMID:24035544]
  4. Kurepa J,Li Y,Perry SE,Smalle JA
    Ectopic expression of the phosphomimic mutant version of Arabidopsis response regulator 1 promotes a constitutive cytokinin response phenotype.
    BMC Plant Biol., 2014. 14: p. 28
    [PMID:24423196]
  5. Cortleven A, et al.
    A novel protective function for cytokinin in the light stress response is mediated by the Arabidopsis histidine kinase2 and Arabidopsis histidine kinase3 receptors.
    Plant Physiol., 2014. 164(3): p. 1470-83
    [PMID:24424319]
  6. Marín-de la Rosa N, et al.
    Genome Wide Binding Site Analysis Reveals Transcriptional Coactivation of Cytokinin-Responsive Genes by DELLA Proteins.
    PLoS Genet., 2015. 11(7): p. e1005337
    [PMID:26134422]
  7. D'Alessandro S,Golin S,Hardtke CS,Lo Schiavo F,Zottini M
    The co-chaperone p23 controls root development through the modulation of auxin distribution in the Arabidopsis root meristem.
    J. Exp. Bot., 2015. 66(16): p. 5113-22
    [PMID:26163704]
  8. Jiang L, et al.
    Strigolactones spatially influence lateral root development through the cytokinin signaling network.
    J. Exp. Bot., 2016. 67(1): p. 379-89
    [PMID:26519957]
  9. Moubayidin L, et al.
    A SCARECROW-based regulatory circuit controls Arabidopsis thaliana meristem size from the root endodermis.
    Planta, 2016. 243(5): p. 1159-68
    [PMID:26848984]
  10. Muraro D, et al.
    A multi-scale model of the interplay between cell signalling and hormone transport in specifying the root meristem of Arabidopsis thaliana.
    J. Theor. Biol., 2016. 404: p. 182-205
    [PMID:27157127]
  11. Cortleven A, et al.
    Cytokinin Regulates the Etioplast-Chloroplast Transition through the Two-Component Signaling System and Activation of Chloroplast-Related Genes.
    Plant Physiol., 2016. 172(1): p. 464-78
    [PMID:27388681]
  12. Kobayashi K, et al.
    Shoot Removal Induces Chloroplast Development in Roots via Cytokinin Signaling.
    Plant Physiol., 2017. 173(4): p. 2340-2355
    [PMID:28193764]
  13. Zhang TQ, et al.
    A Two-Step Model for de Novo Activation of WUSCHEL during Plant Shoot Regeneration.
    Plant Cell, 2017. 29(5): p. 1073-1087
    [PMID:28389585]
  14. Kushwah S,Laxmi A
    The interaction between glucose and cytokinin signaling in controlling Arabidopsis thaliana seedling root growth and development.
    Plant Signal Behav, 2017. 12(5): p. e1312241
    [PMID:28467152]
  15. Meng WJ, et al.
    Type-B ARABIDOPSIS RESPONSE REGULATORs Specify the Shoot Stem Cell Niche by Dual Regulation of WUSCHEL.
    Plant Cell, 2017. 29(6): p. 1357-1372
    [PMID:28576846]
  16. Kobayashi K,Iwase A
    Simultaneous but spatially different regulation of non-photosynthetic callus formation and photosynthetic root development after shoot removal.
    Plant Signal Behav, 2017. 12(6): p. e1338999
    [PMID:28594268]
  17. Liu B,De Storme N,Geelen D
    Cold interferes with male meiotic cytokinesis in Arabidopsis thaliana independently of the AHK2/3-AHP2/3/5 cytokinin signaling module.
    Cell Biol. Int., 2017. 41(8): p. 879-889
    [PMID:28618065]
  18. Zhang F,May A,Irish VF
    Type-B ARABIDOPSIS RESPONSE REGULATORs Directly Activate WUSCHEL.
    Trends Plant Sci., 2017. 22(10): p. 815-817
    [PMID:28886911]
  19. Yan Z, et al.
    Type B Response Regulators Act As Central Integrators in Transcriptional Control of the Auxin Biosynthesis Enzyme TAA1.
    Plant Physiol., 2017. 175(3): p. 1438-1454
    [PMID:28931628]
  20. Rong XF, et al.
    Type-B ARRs Control Carpel Regeneration Through Mediating AGAMOUS Expression in Arabidopsis.
    Plant Cell Physiol., 2018. 59(4): p. 756-764
    [PMID:29186581]
  21. Bustillo-Avendaño E, et al.
    Regulation of Hormonal Control, Cell Reprogramming, and Patterning during De Novo Root Organogenesis.
    Plant Physiol., 2018. 176(2): p. 1709-1727
    [PMID:29233938]
  22. Waldie T,Leyser O
    Cytokinin Targets Auxin Transport to Promote Shoot Branching.
    Plant Physiol., 2018. 177(2): p. 803-818
    [PMID:29717021]