PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang11g13650.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family GRF
Protein Properties Length: 358aa    MW: 40271.8 Da    PI: 8.7477
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang11g13650.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC77.99.9e-2578121144
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                     d+epgrCrRtDGKkWRCs+++++++k+CErH+hrg++rsrk++e
  Vang11g13650.1  78 DPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRKPVE 121
                     79***************************************987 PP

2QLQ56.96.4e-201044236
             QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
                    +FT++Q+q+L++Q+l+yKy+a++  +Pp+Ll+ i+
  Vang11g13650.1 10 PFTPSQWQELEHQALIYKYMASGISIPPDLLFTIK 44
                    8******************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.3E-11945IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088808.4E-151043IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.361045IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.9878122IPR014977WRC domain
PfamPF088791.2E-2079121IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
LMMNGRNRFP FTPSQWQELE HQALIYKYMA SGISIPPDLL FTIKRTHLDS PLSSRLLPHQ  60
SQHFGWNYLP MGLGRKIDPE PGRCRRTDGK KWRCSKEAYP DSKYCERHMH RGKNRSRKPV  120
EVLKTSPTTA TTITDASTPT ILSITKNSPA LSPTTHSLSH DTYHHHHPQH SPHSFLYHHP  180
SRPSSGVALS FQDNSAPLYV YGLKEEVDEH AFFTEPSGTM RSFSASSMED SWQLTPLTIS  240
SSSSSKQRSC SGLSNDNNEY SYLQLQSLSG NNSKQPQQDQ ACYISGSGSG IKCETFMKLG  300
KEEPQKTVHR FFDEWPPKSR GSWLDLDDKS STTQLSISIP TSSHDFATFS STTQRDG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007154592.10.0hypothetical protein PHAVU_003G131800g
TrEMBLV7CCG70.0V7CCG7_PHAVU; Uncharacterized protein
STRINGGLYMA13G16924.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40433459
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.17e-56growth-regulating factor 5