PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang11g12950.1
Common NameLR48_Vigan01g246700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family ARR-B
Protein Properties Length: 667aa    MW: 73485.1 Da    PI: 5.7307
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang11g12950.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like78.77.2e-25209262155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     k+rl+W +eLH++F+ a++qL G++kA Pk+il+lm+++gL++e+v+SHLQk+Rl
  Vang11g12950.1 209 KTRLVWDTELHNKFLAAINQL-GIDKAFPKKILDLMNIDGLSRENVASHLQKFRL 262
                     68*******************.********************************8 PP

2Response_reg80.17.3e-27131211109
                     EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTT CS
    Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaG 93 
                     vl vdD+++ + +l+++l+k +y +v++++++ +ale+l++++  +Dl++ D++mp+mdG++ll++   e  +lp+i+++++g++e + + + +G
  Vang11g12950.1  13 VLAVDDDRTYLTVLENLLRKCQY-NVTATTQSVKALEMLRKNRneFDLVISDVNMPEMDGFKLLQQVGLET-DLPVIMLSGYGDKERVMKGVIYG 105
                     799********************.***************999999**********************7766.8********************** PP

                     ESEEEESS--HHHHHH CS
    Response_reg  94 akdflsKpfdpeelvk 109
                     a dfl+Kp+ ++el +
  Vang11g12950.1 106 ACDFLTKPVRIQELQN 121
                     *************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363921.0E-1351665IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23002.0E-4010144No hitNo description
SuperFamilySSF521722.7E-3410133IPR011006CheY-like superfamily
SMARTSM004485.1E-3011123IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011041.81412127IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.4E-2413121IPR001789Signal transduction response regulator, receiver domain
CDDcd001568.26E-2714126No hitNo description
Gene3DG3DSA:1.10.10.601.4E-24206266IPR009057Homeodomain-like
PROSITE profilePS5129410.2206265IPR017930Myb domain
SuperFamilySSF466891.79E-17207266IPR009057Homeodomain-like
TIGRFAMsTIGR015575.5E-22209262IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0010082Biological Processregulation of root meristem growth
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0031537Biological Processregulation of anthocyanin metabolic process
GO:0048367Biological Processshoot system development
GO:0080022Biological Processprimary root development
GO:0080036Biological Processregulation of cytokinin-activated signaling pathway
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 667 aa     Download sequence    Send to blast
MVEEDHFPVG LRVLAVDDDR TYLTVLENLL RKCQYNVTAT TQSVKALEML RKNRNEFDLV  60
ISDVNMPEMD GFKLLQQVGL ETDLPVIMLS GYGDKERVMK GVIYGACDFL TKPVRIQELQ  120
NIWQHVVRRK IDSKDKNKTA SEEKDCSMAC KFANEEEPCT VAGECSQAFA PKTNANQNIK  180
VDHKRKERCE AEEIEEDDKE NDEPSNQKKT RLVWDTELHN KFLAAINQLG IDKAFPKKIL  240
DLMNIDGLSR ENVASHLQKF RLGLKKPNPY HRMGSVDCFR TSSESGAMLS TTSPSYAYAP  300
GGRFSVLNSP SCLNTRGMNS SATVQASQSR NINSSSIKTH GNMHSSMFSA NQTSSLLQGI  360
PTSMEANLFK PNNSAAGIRR FNPLDHSAAL KDFSSFSENI ATVRNAANIS LPGLSNNHLL  420
FQGISQLKHH SEAFRNHSSF GAAAVKTQSF DPNSFGYSKM GGDYSNKRWQ EAAPISTCPS  480
NTSAVSNVFN NDQLLQHNFK LSSSNFCSRN SPVGFSSSVP LEDDVLGEML HQEGLLGNIL  540
LASCYTQHNQ GGCSKDTSQT FNSINPVISS NGGTSSLGHS YEQNSTVDNN IIDASLVGQM  600
NGVNPSITVC SEGENFYSMK SNDAYVLQSM KSGEGLLQNS LESLDDILNE IDEQDLNAIM  660
LMNEDL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A5e-24207266362ARR10-B
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang11g12950.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017419207.10.0PREDICTED: two-component response regulator ARR12-like
TrEMBLA0A0L9TQY40.0A0A0L9TQY4_PHAAN; Two-component response regulator
STRINGXP_007154913.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.12e-92response regulator 12
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]