PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang11g11480.1
Common NameLR48_Vigan01g283500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family Nin-like
Protein Properties Length: 288aa    MW: 33888.3 Da    PI: 4.6356
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang11g11480.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK82.44.5e-26138187352
          RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                      ++s +++s+yF++pi++AA+e++v+lT+LK++CR++GI+RWPhRk+ sl
  Vang11g11480.1 138 RKLSRKTISEYFYMPITQAAREMNVGLTLLKKRCRELGIRRWPHRKLMSL 187
                     68999******************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.746122207IPR003035RWP-RK domain
PfamPF020421.4E-20140187IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0051302Biological Processregulation of cell division
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MIMDSHPLMS WSSYYQIEEN PLPFTCQFSY SENSEVYPPP LQDLPIQEYH HDAVPLTEYY  60
PSDPLYETLA IEPTPTLRAD CDFYDISKGL PVWNEVNAVF DSEVDFLFRK KEESLKEMVD  120
DRKVNEGREE ITNPRNSRKL SRKTISEYFY MPITQAAREM NVGLTLLKKR CRELGIRRWP  180
HRKLMSLQTL INNVQELLKE EGPESEEKLR FAIETLENEK KLLEEMPDIE LEDNTKRLRQ  240
ACFKANYKKR KLGQREPECS SWSGAMSEYN NESEEELDMK YLLSQLA*
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang11g11480.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017419709.10.0PREDICTED: protein RKD1-like
TrEMBLA0A0L9TSY20.0A0A0L9TSY2_PHAAN; Uncharacterized protein
STRINGXP_007155308.11e-159(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61843052
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.11e-42RWP-RK domain-containing protein
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]