PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang11g10330.1
Common NameLR48_Vigan01g278800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family LBD
Protein Properties Length: 271aa    MW: 31088.1 Da    PI: 6.2919
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang11g10330.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260116.91.2e-36171161100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     aCaaCk++rrkC+++C lapyfpa+qpk f nvh+lFG+sn++k+lk l+++++++am+s++ +A+ r + Pv+G+ + i +lq q+  +++el+
  Vang11g10330.1  17 ACAACKHQRRKCTSECLLAPYFPADQPKVFLNVHRLFGVSNIVKILKILEPNQKKIAMDSIIIQANYRDKYPVHGCWEEICRLQYQIWLAEEELH 111
                     7*********************************************************************************************9 PP

          DUF260  96 llkee 100
                     ++ ++
  Vang11g10330.1 112 AVYQQ 116
                     99887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.67916117IPR004883Lateral organ boundaries, LOB
PfamPF031958.8E-3617113IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009556Biological Processmicrosporogenesis
GO:0009786Biological Processregulation of asymmetric cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
LLLGDSTMTL KGGTTQACAA CKHQRRKCTS ECLLAPYFPA DQPKVFLNVH RLFGVSNIVK  60
ILKILEPNQK KIAMDSIIIQ ANYRDKYPVH GCWEEICRLQ YQIWLAEEEL HAVYQQLQIC  120
RQQQQQQQQQ QHRPPPMPDD VTSQLELGMT PCTNNNALPL FNHHTPQPNT YNNNVTSFSV  180
SQQHSYSNSN CMDYSSLYLD SKDNAMNPLW VQYPCSNNDN SVGMQTPMLS SQPLPIQQNV  240
VEDYVDMPPI FYSLDDRQSY IYSKEAYESR *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-25131177111LOB family transfactor Ramosa2.1
5ly0_B1e-25131177111LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang11g10330.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017435567.10.0PREDICTED: LOB domain-containing protein 27-like
TrEMBLA0A0L9TS070.0A0A0L9TS07_PHAAN; Uncharacterized protein
TrEMBLA0A0S3R8A10.0A0A0S3R8A1_PHAAN; Uncharacterized protein
STRINGXP_007155357.11e-173(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44152958
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.13e-45LOB domain-containing protein 27
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]