PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang11g06920.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family TALE
Protein Properties Length: 340aa    MW: 38355.4 Da    PI: 6.9372
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang11g06920.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.21.2e-072883212154
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     k +yp+++++++L +++gL+ +q+ +WF N+R +
  Vang11g06920.1 288 KWPYPTEDDKAKLVEETGLQLKQINNWFINQRKR 321
                     469*****************************87 PP

2ELK25.23.7e-09242263122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELK +L++++++++ ++++E++
  Vang11g06920.1 242 ELKIELKQGFKSRIEDVREEIL 263
                     9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.7E-1878122IPR005540KNOX1
PfamPF037902.6E-1780120IPR005540KNOX1
SMARTSM012565.3E-22132187IPR005541KNOX2
PfamPF037911.4E-16136186IPR005541KNOX2
PROSITE profilePS512139.132242262IPR005539ELK domain
PROSITE profilePS5007111.645262325IPR001356Homeobox domain
SuperFamilySSF466893.94E-16264329IPR009057Homeodomain-like
SMARTSM003893.4E-11264329IPR001356Homeobox domain
CDDcd000865.59E-12265326No hitNo description
Gene3DG3DSA:1.10.10.601.9E-25269327IPR009057Homeodomain-like
PfamPF059201.3E-17282321IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
CFHASIASPL PLPYIEWSST QPHSFPLNNP SLSNSIILTP FSSLNHSPPR ALQMQEAGLA  60
MNMLSAEVSA AAADHHHRQL KADIATHPLY EQLLAAHVSC LRVATPIDQL PLIDAQLSHF  120
NNLLRSYASH HSHSHSHDRQ ELDNFMTQYL IVLCALKEQL QQHVRVHAVE AVMACRDIES  180
TLQALTVSLG EGSGATMSDD EEDFQMDGSL DQSSAEGHDM MGFGPLLPTE SERSLMERVR  240
QELKIELKQG FKSRIEDVRE EILRKRRAGK LPGDTTSVLK AWWQQHAKWP YPTEDDKAKL  300
VEETGLQLKQ INNWFINQRK RNWHSNSQSV TSLKSKRKR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A1e-12265321864Homeobox protein PKNOX1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1318338RKRNWHSNSQSVTSLKSKRKR
Functional Description ? help Back to Top
Source Description
UniProtPossible developmental regulator.
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang11g06920.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By wounding; up to 7-fold increase.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0939000.0BT093900.1 Soybean clone JCVI-FLGm-17N4 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007155574.10.0hypothetical protein PHAVU_003G213500g
SwissprotP466061e-157HD1_BRANA; Homeobox protein HD1
TrEMBLV7CDX50.0V7CDX5_PHAVU; Uncharacterized protein
STRINGXP_007155574.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF63483450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62990.11e-156KNOTTED-like homeobox of Arabidopsis thaliana 7
Publications ? help Back to Top
  1. Boivin R,Hamel F,Beauseigle D,Bellemare G
    Stage-specific transcription of the homebox gene Bnhd1 in young tissues and flowers of Brassica napus.
    Biochim. Biophys. Acta, 1994. 1219(1): p. 201-4
    [PMID:7916213]