PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang11g03640.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family LBD
Protein Properties Length: 502aa    MW: 56009.3 Da    PI: 6.563
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang11g03640.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.81.6e-42521511100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrrkC+++Cv+apyfp ++p++f++vh++FGasnv+kll++l+  +r+da++sl+yeAear+rdPvyG+vg+i+ lqq+l+q + el+
  Vang11g03640.1  52 PCAACKLLRRKCTQECVFAPYFPPDNPQRFECVHRVFGASNVSKLLNELSVAQRDDAVKSLAYEAEARLRDPVYGCVGIISLLQQRLRQIQMELQ 146
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++k+e
  Vang11g03640.1 147 SAKKE 151
                     99987 PP

2DUF260105.25.5e-333304291100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +C aCk++rr+C +dCv+  yfpae+ ++fa+vh++FG  nv+++l++++++ r+ ++++l+y+Aear+rdPv+G+vg+i++ ++ l  lk++l+
  Vang11g03640.1 330 PCGACKYQRRRCGSDCVMVSYFPAESIQRFAYVHHVFGGGNVSNILRSTSPDLRKWVARALAYQAEARVRDPVHGCVGLIWEQEETLGILKEKLE 424
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++k+e
  Vang11g03640.1 425 KAKRE 429
                     99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.52151152IPR004883Lateral organ boundaries, LOB
PfamPF031954.3E-4252149IPR004883Lateral organ boundaries, LOB
PROSITE profilePS5089122.432329430IPR004883Lateral organ boundaries, LOB
PfamPF031956.2E-32330427IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 502 aa     Download sequence    Send to blast
MRNDIASSKK DCLWQNYCPY YHYETNDHNH ELTWFIQLTE GRLGKMSSLN SPCAACKLLR  60
RKCTQECVFA PYFPPDNPQR FECVHRVFGA SNVSKLLNEL SVAQRDDAVK SLAYEAEARL  120
RDPVYGCVGI ISLLQQRLRQ IQMELQSAKK ELSTYVSPQT MQILLANPGM VPSADIVVPP  180
SHQPLFNHVG NNMAPQQILV GHGGGQTMDR DPQQQDFQEA QQIALATREQ QQQMFRNYEQ  240
KVFGGFEPSN GGFGTQGELL SPLALGNFGN VGAYQMQQLG EQHLIESQLL LSPQQGQPHQ  300
QQQCESEDTK NVLDFSVNSA VVEEEQGMTP CGACKYQRRR CGSDCVMVSY FPAESIQRFA  360
YVHHVFGGGN VSNILRSTSP DLRKWVARAL AYQAEARVRD PVHGCVGLIW EQEETLGILK  420
EKLEKAKREL AQYVGPDVMQ KMIGQCSSDP HAKTVDLKAP LSAPVDFDLS SWDPFPAWES  480
SSSRRLPSQA DAKGKTIAPP S*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A7e-44504339127LOB family transfactor Ramosa2.1
5ly0_B7e-44504339127LOB family transfactor Ramosa2.1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtControls the proximal-distal patterning in petals and the adaxial-abaxial determination of leaves. Involved in the repression of the homeobox gene BP. {ECO:0000269|PubMed:12787254, ECO:0000269|PubMed:15821980}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang11g03640.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017410308.11e-180PREDICTED: LOB domain-containing protein 36
RefseqXP_017410309.11e-180PREDICTED: LOB domain-containing protein 36
RefseqXP_017410311.11e-180PREDICTED: LOB domain-containing protein 36
SwissprotQ9FKZ32e-56LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A0L9TGF21e-178A0A0L9TGF2_PHAAN; Uncharacterized protein
TrEMBLA0A0S3R4R91e-178A0A0S3R4R9_PHAAN; Uncharacterized protein
STRINGXP_007155957.11e-153(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF4080522
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.11e-50ASYMMETRIC LEAVES 2-like 1
Publications ? help Back to Top
  1. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]
  2. Wang Z,Wang Y,Kohalmi SE,Amyot L,Hannoufa A
    SQUAMOSA PROMOTER BINDING PROTEIN-LIKE 2 controls floral organ development and plant fertility by activating ASYMMETRIC LEAVES 2 in Arabidopsis thaliana.
    Plant Mol. Biol., 2016. 92(6): p. 661-674
    [PMID:27605094]