PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang11g03540.1
Common NameLR48_Vigan727s002200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family G2-like
Protein Properties Length: 363aa    MW: 40580.8 Da    PI: 7.2795
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang11g03540.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1031.8e-32227282156
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                     k+r++W+peLH+rFv+a++qLGG+++AtPk+i+elm+v gLt+++vkSHLQkYRl+
  Vang11g03540.1 227 KQRRCWSPELHRRFVDALQQLGGPQVATPKQIRELMQVVGLTNDEVKSHLQKYRLH 282
                     79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.499224284IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.6E-29225285IPR009057Homeodomain-like
SuperFamilySSF466893.12E-18225285IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-26227282IPR006447Myb domain, plants
PfamPF002493.5E-8229280IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MELSLDLSLA FVPGRTVRQI LGEVAQNEGG SQRMATLEDF LLKLEDEKRK IESFKRELPL  60
CMVLVNDAVT KLKEEINGGV RMQEGPVVEE YMPLLKTNSE GSETLNMGKE RSNMKNWMNS  120
VRLWNVESKP RTEEDDRCVP HNPNQPQNET NKSRGAAAAL NGNNCVLKTV MSEDKRVSQA  180
PSHGLMRPVF ESNDRKAESS NEHGSSLITT STLEIKGQAQ PQQNPRKQRR CWSPELHRRF  240
VDALQQLGGP QVATPKQIRE LMQVVGLTND EVKSHLQKYR LHFRRPQVCS VEVANGGLCL  300
MVKDKHGDNN KSKGNLSQSG SPQGPLFLGG SGRNSMDTEE DEQSDCHNWK GALHHQPEAE  360
LL*
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang11g03540.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017410297.10.0PREDICTED: myb family transcription factor EFM-like isoform X1
TrEMBLA0A0L9TG550.0A0A0L9TG55_PHAAN; Uncharacterized protein
TrEMBLA0A0S3R4E70.0A0A0S3R4E7_PHAAN; Uncharacterized protein
STRINGXP_007155959.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.15e-48G2-like family protein
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]