PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang11g02130.1
Common NameLR48_Vigan01g153600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family G2-like
Protein Properties Length: 327aa    MW: 36340.5 Da    PI: 9.9666
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang11g02130.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like88.18.4e-28160209251
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                     pr+rWt+ LH+rFv++v+ LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ
  Vang11g02130.1 160 PRMRWTTALHARFVHVVQLLGGHERATPKSVLELMDVKDLTLAHVKSHLQ 209
                     9************************************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.45E-13157209IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.3E-24158209IPR009057Homeodomain-like
TIGRFAMsTIGR015574.5E-20160209IPR006447Myb domain, plants
PfamPF002491.4E-5161209IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
LSFEKMELFP VQPDLSLKIN PPNTKPTSSN WNKRSTEDEM DLGFWKRALE SKTVKTDLSL  60
SNPRAFSSSS SSCSSNTNTP NPNPILIHHH FQNNTANTNK HNPIQQNHFF HHQDLGFLRP  120
IRGIPLYQNP PFSFPPTSST PFLNPAFLSR FPPKRNIRAP RMRWTTALHA RFVHVVQLLG  180
GHERATPKSV LELMDVKDLT LAHVKSHLQL KLGQSDTYDN GSSGDTSEDL VFDRNSPRRS  240
DLSIRQARTS VNQDIGNGGL WNNSSRQAFL HGKPNLDSIG NVPSAEGMDP KGQSNEISDG  300
NSSSDIAESS GKKLNLDLEF TLGRSL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-14161209452Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-14161209452Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-14161209351Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-14161209351Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-14161209351Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-14161