PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang10g01990.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family CPP
Protein Properties Length: 615aa    MW: 66301 Da    PI: 7.5434
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang10g01990.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR44.43.4e-1489128242
             TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42 
                     ++k+CnCk+skClk+YCeCfa+g +C+  C+C +C N+ e+
  Vang10g01990.1  89 KQKQCNCKHSKCLKLYCECFASGIYCDG-CNCVNCYNNVEN 128
                     89**************************.********9875 PP

2TCR50.83.2e-16173212140
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     k++kgC+Ckks ClkkYCeCf+a+  Cse+CkC dCkN e
  Vang10g01990.1 173 KHNKGCHCKKSGCLKKYCECFQANILCSENCKCMDCKNFE 212
                     589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011143.0E-1688128IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.1189213IPR005172CRC domain
PfamPF036384.4E-1190125IPR005172CRC domain
SMARTSM011148.4E-20173214IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.2E-12176211IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 615 aa     Download sequence    Send to blast
MGEGEGEGSD CAPKNVVPND VVANALLPSD VPAKKLARQL DFTGFGGMPP QSPVVLPLPP  60
SASVRVGKPE SPKSRPRPGF EIKEATPKKQ KQCNCKHSKC LKLYCECFAS GIYCDGCNCV  120
NCYNNVENEA ARREAVEATL ERNPNAFRPK IASSPHGTRD SREDAGEILI LGKHNKGCHC  180
KKSGCLKKYC ECFQANILCS ENCKCMDCKN FEGSEERQAL FHGDQNNNMV YIQQAANAAI  240
TGAIGSSGYS SPPISKKRKG QELLFGSTIK DPSLGRLGQQ EEGPSQKANP LSRWPQGLRF  300
HLEQVFLWFV FTVSRLPRSC QLASVKAPFV VTQACQESPC LKTSLANNVR VPAPSSSMSP  360
IPGARVGPAT LGPSKLMYRS LLADIIQPQH LKELCSVLVL VSGQAAKTFT DQKNLMDKHA  420
EDHTETSLAS STHEQLPNQK EANVEKAMAD DDCLSANQTD KISPDNSCSD GADVPKGRPM  480
SPGTLALMCD EQDTMFMTSA SPIGSRAHAC NTSSQPPYGQ GMTEVYAEQE KIVLTKFRDF  540
LNRVITMGEI NETKCSSLAR SELESEKDPN NNCTGNTSTE TAHQQGTTNN VVAKAAGNIT  600
STSSFPGGSL IPEK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A1e-32812222132Protein lin-54 homolog
5fd3_B1e-32812222132Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang10g01990.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028233843.10.0protein tesmin/TSO1-like CXC 5
SwissprotQ9SZD11e-160TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLA0A445KT980.0A0A445KT98_GLYSO; Protein tesmin/TSO1-like CXC 5 isoform A
STRINGGLYMA05G35561.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26263379
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.12e-93Tesmin/TSO1-like CXC domain-containing protein