PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang09g06330.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family GRF
Protein Properties Length: 300aa    MW: 33896.3 Da    PI: 7.8596
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang09g06330.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC78.37.6e-252871144
             WRC  1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44
                    d+epgrCrRtDGKkWRCs+++++++k+CErH+hrg++rsrk++e
  Vang09g06330.1 28 DPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRKPVE 71
                    79***************************************987 PP

2QLQ31.45.9e-12825219
             QLQ  2 aFTaaQlqlLksQilAyK 19
                    +FT++Q+q+L++Q+l+yK
  Vang09g06330.1  8 PFTPSQWQELEHQALIYK 25
                    8****************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF088801.6E-7825IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.982872IPR014977WRC domain
PfamPF088799.5E-212971IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MNGRNRFPFT PSQWQELEHQ ALIYKKIDPE PGRCRRTDGK KWRCSKEAYP DSKYCERHMH  60
RGKNRSRKPV EVLKTTPSTN TNASTQQPIS SITKLNTLSP LASSESHQHH PPHYTSFLYH  120
HPPSSRSFED NSAPLFLDTG SCSQSNADCR SRYAYGEKEE VDEHAFFTEP CGIMKSFSAS  180
SMDDSWQLTP LAMSSSSSST KQRSSFGLSN DYSCLQLQSH SKQHEQQDQG GCYMLGGGQL  240
GKEEPQKTVH RFFDEWPHKG RQGSWLDLDD KSSTTQLSIS IPTSSHDFPA FSSRTHHDG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150350.0AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014501146.10.0PREDICTED: growth-regulating factor 1-like
TrEMBLA0A0S3RHD00.0A0A0S3RHD0_PHAAN; Uncharacterized protein
STRINGGLYMA09G07990.11e-168(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40433459
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.13e-28growth-regulating factor 5