PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang09g03860.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family G2-like
Protein Properties Length: 300aa    MW: 33403.5 Da    PI: 6.9969
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang09g03860.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like53.55.2e-172062372556
         G2-like  25 ekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                     ++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Vang09g03860.1 206 KVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 237
                     68****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.3E-15205240IPR009057Homeodomain-like
SuperFamilySSF466894.48E-7205240IPR009057Homeodomain-like
TIGRFAMsTIGR015574.2E-14206237IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MASQAELSME YKPYTYSTLL KSFADQTDQT YKLEDFLSRL EEERLKIDAF KRELPLCMQL  60
LTNAVDASRQ QLQNFRSNQG TRPILEEFIP IKHPNSQEST EKASNISDKA SWMTSAQLWS  120
QASEGTKPKS TITSPKESAD TGFSVSPRLA LEHRNGGAFL PFSKERNSCQ GIGDLPELGL  180
ACSESEMEVK KCEETEKCSK RENSGKVATP KQIRELMKVD GLTNDEVKSH LQKYRLHTRR  240
PSPSLHAGAP TPQLVVLGGI WVPPEYATAA AHSDGTSFYS PHPTSHVPPQ HYCDSNTLR*
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor acting as a flowering repressor, directly repressing FT expression in a dosage-dependent manner in the leaf vasculature. {ECO:0000269|PubMed:25132385}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang09g03860.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by SVP. Down-regulated by high temperature and gibberellic acid treatment. Not regulated by photoperiod, circadian rhythm under long days or vernalization. {ECO:0000269|PubMed:25132385}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150350.0AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027942696.11e-176myb family transcription factor EFM-like
SwissprotQ9ZQ856e-83EFM_ARATH; Myb family transcription factor EFM
TrEMBLA0A4D6NNF61e-174A0A4D6NNF6_VIGUN; Two-component response regulator ARR-B family
STRINGXP_007138330.11e-153(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF54663455
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.13e-85G2-like family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]