PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang09g02510.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family Nin-like
Protein Properties Length: 238aa    MW: 27702.2 Da    PI: 7.9773
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang09g02510.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK81.49.4e-26156204452
          RWP-RK   4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                      +s +++s+yF++pi +AAkeL+v+lT LK++CR++GI+RWPhRk+ sl
  Vang09g02510.1 156 ILSRKTVSQYFYMPISQAAKELNVGLTHLKKRCRELGIQRWPHRKLMSL 204
                     57899*****************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.097140226IPR003035RWP-RK domain
PfamPF020421.0E-21157204IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MENQQLTFWN SNYQIDENSF APTCQFSYDY FRKSYHVSIF NFCRGNASDG FHWPYEFPLQ  60
DSYFDVVPFM KCYYPHDILY ETLPLEPTPL SFQGFAGADY DFSDVKNVLS AWNEVDVSDH  120
KPAFSSSNDG GSVNETMEEV KGKQHREERI SSSARILSRK TVSQYFYMPI SQAAKELNVG  180
LTHLKKRCRE LGIQRWPHRK LMSLQTLIKN MQIWNLKIKQ EGLDKLVSRL TTRRGNS*
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang09g02510.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150350.0AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014495091.11e-133protein RKD1
SwissprotQ9CA668e-27RKD2_ARATH; Protein RKD2
TrEMBLA0A1S3TMU61e-132A0A1S3TMU6_VIGRR; protein RKD1
STRINGGLYMA06G20881.14e-95(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61843052
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74480.13e-29RWP-RK domain-containing protein
Publications ? help Back to Top
  1. Tedeschi F,Rizzo P,Rutten T,Altschmied L,Bäumlein H
    RWP-RK domain-containing transcription factors control cell differentiation during female gametophyte development in Arabidopsis.
    New Phytol., 2017. 213(4): p. 1909-1924
    [PMID:27870062]