PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang09g01650.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family ARR-B
Protein Properties Length: 589aa    MW: 63871.5 Da    PI: 5.3269
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang09g01650.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like49.11.2e-151451752555
         G2-like  25 ekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     e+A+Pk+il+lm+v+gLt+e+v+SHLQkYRl
  Vang09g01650.1 145 EEAVPKKILDLMNVEGLTRENVASHLQKYRL 175
                     57****************************8 PP

2Response_reg55.82.7e-194611440109
                     HHHHESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTESEEEESS--HHHHHH CS
    Response_reg  40 kekdpDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGakdflsKpfdpeelvk 109
                     +++++Dl++ D++mp+mdG++ll+     e++lp+i+++ah++ +++ + +  Ga d+l Kp+ +eel +
  Vang09g01650.1  46 CQNKFDLVISDVNMPDMDGFKLLELVGL-EMDLPVIMLSAHSDTKLVMQGVTHGACDYLLKPVRIEELKN 114
                     4566*******************87754.558***********************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011029.2011120IPR001789Signal transduction response regulator, receiver domain
SuperFamilySSF521722.85E-2823126IPR011006CheY-like superfamily
SMARTSM004481.5E-1724116IPR001789Signal transduction response regulator, receiver domain
CDDcd001564.01E-2327119No hitNo description
Gene3DG3DSA:3.40.50.23004.1E-2747137No hitNo description
PfamPF000723.3E-1647114IPR001789Signal transduction response regulator, receiver domain
Gene3DG3DSA:1.10.10.602.3E-15143179IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-13144175IPR006447Myb domain, plants
SuperFamilySSF466892.51E-8144179IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 589 aa     Download sequence    Send to blast
MAVENQRDHL GDEDGGGDRF PVGMRVLAVD DDPLCLKVLE NLLRKCQNKF DLVISDVNMP  60
DMDGFKLLEL VGLEMDLPVI MLSAHSDTKL VMQGVTHGAC DYLLKPVRIE ELKNIWQHVV  120
RRKNFDGRDQ SKASNDEKAL NIAGEEAVPK KILDLMNVEG LTRENVASHL QKYRLYLKKA  180
NHQANMVAAL GGSDSYLRMG SIEGFGDFCT ASGSGRISNT TLPSYASSGI FSRLNSPAGL  240
NMRGISTSAL IRPVQTQNMN SSLNALGNIQ PSIFSANQSS SLLQGIPTSI ELNQSKQSNC  300
STGLSQLSQV DSSAFTVASG FPDSRATTVN GPNNSLSCGS NNHIILQGNP QQTHGPGTFR  360
NQSSVRAASL NAESFGIGGS SNMLDYNRCN KNWQNAAQLS KFPSNPLPLC EAFSNDQLPP  420
TSINVSNSGT HIGNSPVDFS SRMAMTFPLE DVQALSYTPQ QRWEEHKLDY DQNLSRPFNP  480
VNSYASSSAA TSSMGHGLNQ NNTICSNRIN ASLVGPCTEV DKFSSDIPLK SNEAYILEQL  540
KSQEGFMQNT FGTLDDIMGA MVKREQNELT LLDGEIVFDA SYPVGSCN*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang09g01650.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150350.0AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017422635.10.0PREDICTED: two-component response regulator ARR12-like
SwissprotA2X1N28e-80ORR24_ORYSI; Two-component response regulator ORR24
TrEMBLA0A0S3RGS50.0A0A0S3RGS5_PHAAN; Two-component response regulator
STRINGXP_007138266.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.12e-74response regulator 12