PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang08g02160.1
Common NameLR48_Vigan11g105400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family G2-like
Protein Properties Length: 331aa    MW: 37263.5 Da    PI: 8.6806
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang08g02160.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.91.7e-3161114255
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     prlrWtp+LH rFv+av++LGG+e+AtPk +l+lm++kgL+++hvkSHLQ++R+
  Vang08g02160.1  61 PRLRWTPDLHLRFVHAVQRLGGQERATPKLVLQLMNMKGLSIAHVKSHLQMFRS 114
                     8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.29257117IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-2857115IPR009057Homeodomain-like
SuperFamilySSF466894.48E-1460115IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-2261116IPR006447Myb domain, plants
PfamPF002498.9E-962112IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MGESRVSQCS KTSPSNIDEE ECESHANEDQ RKQNNNGGSS SNSTVEESEK KIRPYVRSKL  60
PRLRWTPDLH LRFVHAVQRL GGQERATPKL VLQLMNMKGL SIAHVKSHLQ MFRSKKVDDR  120
NQVFSDHTSL VEIGDKNIYN LSQLSMLQGY NPRQSSSYSY TNNIYPSYGF GDASFGSYEK  180
LVHRPFDWFN GMSRAGSSIS GEQSTSKTRE PKNELFSFGA YENLCTRFKH TPSNIIQQTA  240
QNLMPVNPTT ELKTLKRKAE DSSLDLDLSL KLNTKMDSEG TKLEDHEVHS NLSLSLCSQS  300
SSSNLSSRLK EAKDRCEEHG KRASTLDLTI *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A8e-1762116458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B8e-1762116458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A8e-1762116357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B8e-1762116357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C8e-1762116357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D8e-1762116357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A8e-1762116458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C8e-1762116458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D8e-1762116458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F8e-1762116458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H8e-1762116458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J8e-1762116458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00297DAPTransfer from AT2G38300Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang08g02160.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150420.0AP015042.1 Vigna angularis var. angularis DNA, chromosome 9, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017441916.10.0PREDICTED: two-component response regulator ARR18-like
TrEMBLA0A0L9VSH70.0A0A0L9VSH7_PHAAN; Uncharacterized protein
TrEMBLA0A0S3SWY20.0A0A0S3SWY2_PHAAN; Uncharacterized protein
STRINGXP_007134813.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23783482
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.12e-54G2-like family protein
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]