PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang07g07910.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family CPP
Protein Properties Length: 782aa    MW: 85723.8 Da    PI: 5.8359
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang07g07910.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.83.2e-16492529340
             TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     +k+CnCkkskClk+YCeCfaag++C e C+C+dC+Nk 
  Vang07g07910.1 492 CKRCNCKKSKCLKLYCECFAAGVYCIEPCSCQDCFNKP 529
                     89**********************************96 PP

2TCR50.25.1e-16576614139
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                     ++k+gCnCkks+ClkkYCeC++ g+ Cs  C+Ce+CkN 
  Vang07g07910.1 576 RHKRGCNCKKSSCLKKYCECYQGGVGCSIGCRCEGCKNA 614
                     589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.4E-18490531IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.102491616IPR005172CRC domain
PfamPF036381.1E-11493528IPR005172CRC domain
SMARTSM011146.6E-17576617IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.8E-11578614IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 782 aa     Download sequence    Send to blast
MDTPERNQIS ATLSKFEDSP VFNYINSLSP IKPVKSVPIS QTFNSLSFSS PPSVFTSPHV  60
SCLKESRFLR RHIPLGTWKP KVSSEDVNKV HTSEEEETLA DSKRAHHNKT ESQENTEKRV  120
SIGDASIELS SEHIKFSDEP QQTLKYDTCG SPGYDPSLCD DEDSTLLEIA GEAAADVGYV  180
QEGCKTDSVE SEVHLQEICQ MEPKSEDPDC YWDSLVPDGS DMLIFNSPGE AEAFKGLMHK  240
PLDPSIRLSE FMSVLPLSAV HNGRKMFIVD SVASGSEHEI GDHCSEPTIA ATDTDQTRDN  300
LADVVLVTSN YNENANDQLV SVTHRAIRRR CLDFEMANVQ KKNSDDNSKA SSSTSESDER  360
NVANEKQLLP AKLNGNFQRG ILQGIGLHLN ALAALKEYKG IQIENLSSGR HLSLPNSTSL  420
QITTSQEQQH LSLVPVSSER DLDSSDNVLQ STEDCSQPSV YMAGEDFNKN SPRKKKQVQL  480
RKLETPGETE GCKRCNCKKS KCLKLYCECF AAGVYCIEPC SCQDCFNKPV HEDTVLQTRK  540
QIESRNPLAF APKVIRSSDS VPEIGDDPNK TPASARHKRG CNCKKSSCLK KYCECYQGGV  600
GCSIGCRCEG CKNAFGRKDG SAPVSIETEQ EETETTDKGM AEKASQKTEI QNTEDHPDSA  660
TMLTPLRLSR PLLPLPFSSK GKAPRSFVTT ISGSALFASQ KLGKSNSLWS QSKHFQTVPD  720
DEMPDILLGD TSPITCIKTS SPNGKRISSP SCDLGSSPSR RGGRKLILQS IPSFPSLTSH  780
P*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A3e-1749361312120Protein lin-54 homolog
5fd3_B3e-1749361312120Protein lin-54 homolog
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang07g07910.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150430.0AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017408019.10.0PREDICTED: protein tesmin/TSO1-like CXC 2
TrEMBLA0A0S3T7780.0A0A0S3T778_PHAAN; Uncharacterized protein
STRINGXP_007157112.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26193375
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.11e-134TESMIN/TSO1-like CXC 2