PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang07g06110.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family G2-like
Protein Properties Length: 763aa    MW: 85928.7 Da    PI: 7.9015
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang07g06110.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like993.4e-31245299155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     k+r+rWt++LHe+Fve+v++LGGse+AtPk+il++m+ +gLt+ hvkSHLQkYR+
  Vang07g06110.1 245 KTRIRWTKDLHEKFVECVNRLGGSEQATPKAILKMMDTDGLTIFHVKSHLQKYRI 299
                     68****************************************************7 PP

2G2-like74.11.9e-23571625155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     k r++Wt +LHe F+  v++LGG+ekA Pk+il++mk + L+++hvkSHLQk R+
  Vang07g06110.1 571 KRRIKWTDDLHEPFMMIVNSLGGPEKAKPKAILDMMKSDLLSISHVKSHLQKCRS 625
                     689*************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.655242302IPR017930Myb domain
SuperFamilySSF466891.11E-16243299IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-27243300IPR009057Homeodomain-like
TIGRFAMsTIGR015579.5E-23245300IPR006447Myb domain, plants
PfamPF002491.1E-8249298IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-20569627IPR009057Homeodomain-like
SuperFamilySSF466891.13E-10570627IPR009057Homeodomain-like
TIGRFAMsTIGR015573.7E-18571625IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 763 aa     Download sequence    Send to blast
MNENKVHWGG LIQQSHGLSG DFNSEFGNHY CQYFDIRQPW NMGPLAMVGR EATDQLPNIG  60
HVKSSGTIIS RFESPASAFY AAENCMGFAE YDCQLGVQSQ LCKINDSEFP LYQSPRDNLF  120
LDSANQPDLS YDFSNTLQSI VKSQFNNDQC RVSPEKFNKI SCGNFPTTKF LPIEQQKLFI  180
DGVIRGSSFP NKGIQDRTVA RGSFDLPVAH MRFSSQIEKL SPTLSAGSVS TVGNSASNGA  240
AVSSKTRIRW TKDLHEKFVE CVNRLGGSEQ ATPKAILKMM DTDGLTIFHV KSHLQKYRIA  300
KFIPEPSQGK SDKRSHIKNV HHLDVKTGLQ IREALKLQLD AQRCLHEQLE RSMYQCSSQM  360
YGTDWEYMGI SNLAKVVGSD QILEPKSSPF NIVTTPLQIQ TPQGFCATAT KGLVSFQAQQ  420
HAHHQHQIEV PAWCFDSNML NICQASGDNF TTKQDPPSSQ FTSSLCPVAE SFLSSSTGAD  480
CPSSSEKYCK ITSYSEKHSS MQPDGMPYYD HFSQEEDKLL RDDAATDERP LEISFQRNQL  540
ESCTKPQKQA PHRLCGVACV TSSNSASRRG KRRIKWTDDL HEPFMMIVNS LGGPEKAKPK  600
AILDMMKSDL LSISHVKSHL QKCRSTINMH KALQGKLLLS LPWCYITVMH IPSEIPQNIF  660
LLNCTIGKLN WSENRKLPLC LSEKSEEGQR MDGVAELQVK IHMQIEESRQ LQLEVRRNIC  720
QQLEMQRNLQ MLIQQQSQQL KVMFDYQKKK PKLDTELEAT VP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A6e-23245625159Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B6e-23245625159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A6e-23245625159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C6e-23245625159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D6e-23245625159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F6e-23245625159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H6e-23245625159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J6e-23245625159Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang07g06110.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150370.0AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017411430.10.0PREDICTED: uncharacterized protein LOC108323469
TrEMBLA0A4D6M8A40.0A0A4D6M8A4_VIGUN; Two-component response regulator ARR-B family
STRINGXP_007162313.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37403465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.21e-49G2-like family protein