PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang07g04940.1
Common NameLR48_Vigan03g223300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family HD-ZIP
Protein Properties Length: 204aa    MW: 22879.8 Da    PI: 7.985
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang07g04940.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox53.25.1e-1750104256
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     rk+ +++k+q   Le+ F+++ +++ +++  LAk+l+L  rqV vWFqNrRa+ k
  Vang07g04940.1  50 RKKLRLSKTQSAFLEDSFKEHTTLNPKQKLVLAKELNLRPRQVEVWFQNRRARTK 104
                     778899***********************************************98 PP

2HD-ZIP_I/II125.72e-4050139191
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                     +kk+rlsk q+++LE+sF+e+++L+p++K  la+eL+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr +l
  Vang07g04940.1  50 RKKLRLSKTQSAFLEDSFKEHTTLNPKQKLVLAKELNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCESLSEENKRLQKELQELR-AL 139
                     69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.60146106IPR001356Homeobox domain
SuperFamilySSF466898.13E-1847115IPR009057Homeodomain-like
SMARTSM003897.2E-1548110IPR001356Homeobox domain
CDDcd000862.86E-1450107No hitNo description
Gene3DG3DSA:1.10.10.602.0E-1650104IPR009057Homeodomain-like
PfamPF000461.6E-1450104IPR001356Homeobox domain
PROSITE patternPS00027081104IPR017970Homeobox, conserved site
PfamPF021836.8E-11106140IPR003106Leucine zipper, homeobox-associated
SMARTSM003409.1E-23106149IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MEDTPVRALD DTDDGAAVSS PNNSAVSSFC RNSRKFFEGD SEEDENGSTR KKLRLSKTQS  60
AFLEDSFKEH TTLNPKQKLV LAKELNLRPR QVEVWFQNRR ARTKLKQTEV DCEYLKRCCE  120
SLSEENKRLQ KELQELRALK TCEPFFMQLP ATTLTMCPSC ERVATTTSAA ASATNNDRVS  180
LNKPRILSGP HAAGLHGPSE CFF*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14854TRKKLRL
298106RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang07g04940.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150371e-172AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017418134.11e-148PREDICTED: homeobox-leucine zipper protein HAT14
SwissprotP466651e-75HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLA0A0L9U7Z01e-146A0A0L9U7Z0_PHAAN; Uncharacterized protein
TrEMBLA0A0S3RXN91e-146A0A0S3RXN9_PHAAN; Uncharacterized protein
STRINGXP_007162339.11e-114(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23353382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.13e-75homeobox from Arabidopsis thaliana
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]