PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang07g03030.1
Common NameLR48_Vigan06g023000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family HD-ZIP
Protein Properties Length: 289aa    MW: 32310.4 Da    PI: 8.1819
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang07g03030.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.98.5e-19143197256
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     rk+ ++tkeq   Lee F+++++++ ++++ LA++l+L  rqV vWFqNrRa+ k
  Vang07g03030.1 143 RKKLRLTKEQSALLEESFKQHSTLNPKQKQALARQLNLRPRQVEVWFQNRRARTK 197
                     788899***********************************************98 PP

2HD-ZIP_I/II1253.5e-40143232191
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                     +kk+rl+keq++lLEesF+++++L+p++K++lar+L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lk+++++l++en+rL+ke +eL+ +l
  Vang07g03030.1 143 RKKLRLTKEQSALLEESFKQHSTLNPKQKQALARQLNLRPRQVEVWFQNRRARTKLKQTEVDCEFLKKCCETLTDENRRLKKELQELK-AL 232
                     69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.653139199IPR001356Homeobox domain
SMARTSM003891.0E-15141203IPR001356Homeobox domain
SuperFamilySSF466891.84E-18141207IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-17143197IPR009057Homeodomain-like
CDDcd000864.13E-17143200No hitNo description
PfamPF000463.2E-16143197IPR001356Homeobox domain
PROSITE patternPS000270174197IPR017970Homeobox, conserved site
PfamPF021839.2E-10199233IPR003106Leucine zipper, homeobox-associated
SMARTSM003401.1E-24199242IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009735Biological Processresponse to cytokinin
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MGFDHDASTS GLHLVLGLSL TATTTPSTKP QDHHHHHHHH FCVVKPSPTK PNSPNEPSLT  60
LGLSGDSCHL AKQVPNNSKV YCEDPLDMSR QTSPHSVVSS FSTGRVVKRE RDLSFEEVEA  120
EAEAEERVSS RVSDEEEDGT NARKKLRLTK EQSALLEESF KQHSTLNPKQ KQALARQLNL  180
RPRQVEVWFQ NRRARTKLKQ TEVDCEFLKK CCETLTDENR RLKKELQELK ALKLAQPLYM  240
PMPAATLTMC PSCERLGGVS DNASNKSPFS MAPKTHFYNP FANPSAAC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1191199RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00477DAPTransfer from AT4G37790Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang07g03030.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150430.0AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017426533.10.0PREDICTED: homeobox-leucine zipper protein HAT22-like
SwissprotP466043e-93HAT22_ARATH; Homeobox-leucine zipper protein HAT22
TrEMBLA0A0L9UQV60.0A0A0L9UQV6_PHAAN; Uncharacterized protein
TrEMBLA0A0S3T5V10.0A0A0S3T5V1_PHAAN; Uncharacterized protein
STRINGXP_007156684.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114433107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22800.17e-77HD-ZIP family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]
  3. Liu T,Longhurst AD,Talavera-Rauh F,Hokin SA,Barton MK
    The Arabidopsis transcription factor ABIG1 relays ABA signaled growth inhibition and drought induced senescence.
    Elife, 2017.
    [PMID:27697148]
  4. Song L, et al.
    A transcription factor hierarchy defines an environmental stress response network.
    Science, 2017.
    [PMID:27811239]