PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang07g00620.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family G2-like
Protein Properties Length: 376aa    MW: 41507.4 Da    PI: 7.5267
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang07g00620.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.72.3e-32230285156
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                     k+r++W+peLH+rFv+a++qLGG+++AtPk+i+elm+v++Lt+++vkSHLQkYRl+
  Vang07g00620.1 230 KQRRCWSPELHRRFVDALQQLGGAQVATPKQIRELMQVDSLTNDEVKSHLQKYRLH 285
                     79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.013227287IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-29227288IPR009057Homeodomain-like
SuperFamilySSF466895.02E-18228288IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-26230285IPR006447Myb domain, plants
PfamPF002492.8E-7232283IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010092Biological Processspecification of organ identity
GO:0010629Biological Processnegative regulation of gene expression
GO:0048449Biological Processfloral organ formation
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 376 aa     Download sequence    Send to blast
MVVCDLWEHT LAHRKSPNST QQHSSAFMEL SLDLSLGFVP KPISLFFADV SGNRDKTDKV  60
ATLDGFVQRL EDELRKVEAF KRELPLCMLL LNDAIARLKE EKVKCSVLQD PPTNEQFVPP  120
KTNSGGSENE KCEKKNWMSS AQLWSTQKIK STNEDGDRSV PQNPINGNWC APRKESSQIP  180
SFSLMGHASE LSHSNSKSVC GDTSSGSSLL RVEVQSQPQP PQHMQQNSRK QRRCWSPELH  240
RRFVDALQQL GGAQVATPKQ IRELMQVDSL TNDEVKSHLQ KYRLHVRRFP VSSVGQADNG  300
SWMGQDECGD KSKGNLSQSG SPQGPLTPLL LGGGGSAKGI SSPGRNSVDA EDEQSDCRNW  360
KGGLHQHLEA DNQSL*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00629PBMTransfer from PK14402.1Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang07g00620.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150431e-173AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017426545.10.0PREDICTED: myb family transcription factor EFM
TrEMBLA0A0S3T5I30.0A0A0S3T5I3_PHAAN; Uncharacterized protein
STRINGXP_007156835.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.18e-59G2-like family protein