PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0781s00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family G2-like
Protein Properties Length: 367aa    MW: 40983.9 Da    PI: 9.2824
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0781s00010.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.91.1e-3379133155
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       kprlrWt eLHerFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQk+Rl
  Vang0781s00010.1  79 KPRLRWTVELHERFVDAVAQLGGPDKATPKTIMRVMGVKGLTLYHLKSHLQKFRL 133
                       79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.0E-3276134IPR009057Homeodomain-like
PROSITE profilePS5129412.80176136IPR017930Myb domain
SuperFamilySSF466891.79E-1678134IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-2379134IPR006447Myb domain, plants
PfamPF002492.7E-881131IPR001005SANT/Myb domain
PfamPF143791.7E-21175213IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
VYAAAIAKGF HIFISSSIKT HHIHRICSSI SLYSSQFSSL IREIMDRMFP PKKPSTMNSN  60
DRPMCVQGDS GLVLTTDPKP RLRWTVELHE RFVDAVAQLG GPDKATPKTI MRVMGVKGLT  120
LYHLKSHLQK FRLGKQPHKD FNEHSIKDGM RASALELQRN IGSSSAMIGR NMNEMQMEVQ  180
RRLHEQLEVQ KNLQLRIEAQ GKYMQSILEK AYHTLAHENM GTGMKGVGSA GQGSTEMGKR  240
VCPYSGSGKS PLIWNDDLRL QDLGTASSCI SPEEDPFKGD HKVQISPPSM DSDPMSEIYD  300
TKPLLLHGES VCVGTNHNKF EASMKLERPS PQRSPLQPER NSPMINASSM AQGTINFLLD  360
HNHNYY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A3e-1879135258Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B3e-1879135258Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-1879135157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-1879135157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-1879135157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-1879135157Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A3e-1879135258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C3e-1879135258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D3e-1879135258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F3e-1879135258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H3e-1879135258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J3e-1879135258Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang0781s00010.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150390.0AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017410165.10.0PREDICTED: myb family transcription factor APL-like
TrEMBLA0A0L9TFK80.0A0A0L9TFK8_PHAAN; Uncharacterized protein
TrEMBLA0A0S3SAB40.0A0A0S3SAB4_PHAAN; Uncharacterized protein
STRINGGLYMA15G29620.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF49643252
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79430.21e-101G2-like family protein