PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang06g24170.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family G2-like
Protein Properties Length: 610aa    MW: 67318.6 Da    PI: 6.6839
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang06g24170.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.91.7e-31252306155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     k+r+rWt+eLHe+Fve+v++LGG+ekAtPk+il+lm+ +gLt+ hvkSHLQkYR+
  Vang06g24170.1 252 KTRIRWTQELHEKFVECVNRLGGAEKATPKAILRLMESDGLTIFHVKSHLQKYRI 306
                     68****************************************************7 PP

2G2-like92.24.4e-29484535455
         G2-like   4 lrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     ++Wt++LH++Fv av++LGG++kAtPk++l++m+ k+Lt+ hvkSHLQkYR+
  Vang06g24170.1 484 IKWTKDLHQQFVAAVNNLGGAQKATPKAVLKMMNSKSLTIFHVKSHLQKYRS 535
                     79*************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.404249309IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.3E-28250307IPR009057Homeodomain-like
SuperFamilySSF466891.88E-17250306IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-23252307IPR006447Myb domain, plants
PfamPF002491.1E-8256305IPR001005SANT/Myb domain
PROSITE profilePS512948.033477538IPR017930Myb domain
SuperFamilySSF466892.24E-15479536IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.9E-26480536IPR009057Homeodomain-like
TIGRFAMsTIGR015572.0E-21481535IPR006447Myb domain, plants
PfamPF002491.3E-7485534IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 610 aa     Download sequence    Send to blast
MNEYRIDCVG RIQQSYGLNG DLSSEFGNCS SQCFDIIQAS HMGTCNQPLA MASGGFEEEP  60
HIGQTKSSSS IISRFESPAS AFYATEICMG FPQYDRLVGN PSLISQFSKI SDVEFPLYQS  120
PRQNLFLASL ANQPAPNFEL SNPLQAMLLS HVNSDQCVRS PEKSNKISSG NFPGSSFLPI  180
EQPKLFIGDA SSPSVPCIGN QDQRDCCGSY NLPAAQISFS SQQEMLSPTL SAGSLLTSSG  240
NSSSNGPVVS SKTRIRWTQE LHEKFVECVN RLGGAEKATP KAILRLMESD GLTIFHVKSH  300
LQKYRIAKYM PQSTQGKSEK RTNVENVHLD AKTCCDSNQL SFLFFIASGL QIREALQLQL  360
DELNGVHNSV ANVGGAENNS FNFQHHEQHL FDVPVSCLNF DSQNFLCQSS GDHSPPLFGS  420
VVDSFLFSDE DTFCETYNVY EHFRNEKNNI LEGGASAPVN GVEVVSATSG NSASSMVPTR  480
KKGIKWTKDL HQQFVAAVNN LGGAQKATPK AVLKMMNSKS LTIFHVKSHL QKYRSTMYVK  540
NTSREGHEES HGRDMVTELQ QKICMQIEES RKLQLEIGRG IQEQLELQRN LQMLVQEQKK  600
QVNDANKAN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-23252538259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-23252538259Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-23252538158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-23252538158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-23252538158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-23252538158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-23252538259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-23252538259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-23252538259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-23252538259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-23252538259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-23252538259Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang06g24170.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150410.0AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007145673.10.0hypothetical protein PHAVU_007G258700g
TrEMBLA0A4D6MX040.0A0A4D6MX04_VIGUN; Two-component response regulator ARR-B family
STRINGXP_007145673.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37403465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.27e-43G2-like family protein